QPRT Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17089

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all QPRT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI

Reactivity Notes

Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for QPRT Antibody - BSA Free

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089] - Analysis in human liver and skeletal muscle tissues using Anti-QPRT antibody. Corresponding QPRT RNA-seq data are presented for the same tissues.
Western Blot: QPRT Antibody [NBP3-17089]

Western Blot: QPRT Antibody [NBP3-17089]

Western Blot: QPRT Antibody [NBP3-17089] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: QPRT Antibody [NBP3-17089]

Immunocytochemistry/ Immunofluorescence: QPRT Antibody [NBP3-17089]

Immunocytochemistry/Immunofluorescence: QPRT Antibody [NBP3-17089] - Staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089]

Immunohistochemistry-Paraffin: QPRT Antibody [NBP3-17089] - Staining of human liver shows high expression.

Applications for QPRT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: QPRT

QPRT encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease.

Alternate Names

EC 2.4.2.19, nicotinate-nucleotide pyrophosphorylase (carboxylating), QAPRTase, QPRTasenicotinate-nucleotide pyrophosphorylase [carboxylating], quinolinate phosphoribosyltransferase, Quinolinate phosphoribosyltransferase [decarboxylating]

Gene Symbol

QPRT

Additional QPRT Products

Product Documents for QPRT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for QPRT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for QPRT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review QPRT Antibody - BSA Free and earn rewards!

Have you used QPRT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies