RAB14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79962

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAB14 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB14 Antibody - BSA Free

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962] - Host: Rabbit. Target Name: RAB14. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Immunocytochemistry/ Immunofluorescence: RAB14 Antibody [NBP1-79962]

Immunocytochemistry/ Immunofluorescence: RAB14 Antibody [NBP1-79962]

Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-79962] - Lanes: Murin JAWS-II cell line Primary Antibody Dilution: 1:100 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:1000 Gene Name: Blue: Nucleus Green: Rab14 Submitted by: RAB14
Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.
Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962]

Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Applications for RAB14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB14

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 (PubMed 15004230)).(supplied by OMIM)

Alternate Names

bA165P4.3 (member RAS oncogene family), F protein-binding protein 1, FBP, RAB-14, RAB14, member RAS oncogene family, ras-related protein Rab-14, small GTP binding protein RAB14

Gene Symbol

RAB14

UniProt

NP_057406 (Human)

Additional RAB14 Products

Product Documents for RAB14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAB14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB14 Antibody - BSA Free and earn rewards!

Have you used RAB14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies