Rad21 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15608

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Rad21 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 281-420 of human Rad21 (NP_006256.1). VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rad21 Antibody - Azide and BSA Free

Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]

Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]

Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of C6 cells, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded rat stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]

Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]

Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of various cell lines, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded mouse stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [NBP3-15608]

Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Rad21 antibody (NBP3-15608). Western blot was performed from the immunoprecipitate using Rad21 antibody (NBP3-15608) at a dilition of 1:1000.
Rad21 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Rad21 Antibody - Azide and BSA Free [Rad21] -

Immunocytochemistry/ Immunofluorescence: Rad21 Antibody - Azide and BSA Free [Rad21] - Immunofluorescence analysis of U2OS cells using Rad21 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Rad21 Antibody - Azide and BSA Free

Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -

Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Rad21 Antibody - Azide and BSA Free

Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -

Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug Rad21 antibody. Western blot was performed from the immunoprecipitate using Rad21 antibody at a dilution of 1:1000.
Rad21 Antibody - Azide and BSA Free

Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -

Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Applications for Rad21 Antibody - Azide and BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:500 - 1:1000

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rad21

The cohesin complex plays an important role in tethering sister chromatids during the prophase through anaphase stages of mitosis, making certain that genomic information is replicated accurately. As the cellular division process continues, separase destroys the cohesin complex by means of cleavaging its Scc1 subunit (Mcd1/Scc1/hRad21), allowing the chromatids to separate and divide with the cell. During apoptosis the C-terminal portion of hRad21 is cleaved and translocated to the cytoplasm. This cleavage and translocation may act as a nuclear signal that promotes and accelerates subsequent events of apoptosis (2).

Alternate Names

double-strand-break repair protein rad21 homolog, hHR21FLJ25655, HR21, KIAA0078RAD21 (S. pombe) homolog, MCD1, Nuclear matrix protein 1, NXP-1, NXP1HRAD21, protein involved in DNA double-strand break repair, RAD21 homolog (S. pombe), SCC1 homolog, SCC1FLJ40596

Gene Symbol

RAD21

Additional Rad21 Products

Product Documents for Rad21 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rad21 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rad21 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Rad21 Antibody - Azide and BSA Free and earn rewards!

Have you used Rad21 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies