RAP1GDS1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87027
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23435261)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RAP1GDS1 Antibody - BSA Free
Immunohistochemistry-Paraffin: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Staining of human cell line A-431 shows positivity in cytoplasm.Western Blot: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Analysis in human cell line MOLT-4.Immunohistochemistry-Paraffin: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.Immunohistochemistry-Paraffin: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: RAP1GDS1 Antibody - BSA Free [NBP1-87027]
Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil and neurons.Western Blot: RAP1GDS1 Antibody - BSA Free [NBP1-87027] -
Tiam1 controls the expression of small GTPase and cytoskeletal regulators, and the association of Rasa3 with Rac in neutrophils adhering to ICAM1. Wild type and Tiam1–/– neutrophils were allowed to adhere to 50 mm glass coverslips coated with ICAM1 during priming with 50 ng/ml GM-CSF, 20 ng/ml TNF alpha for 50 min at 37C, 5% CO2. DFP was added for 10 min before neutrophils were stimulated with 1.5 uM fMLP for 1 min and then lysed. The cleared supernatants (total lysates) were incubated with immobilised Rac1G15A to isolate proteins that interact with nucleotide-free Rac. (A) Targeted mass spectrometry was performed for 21 proteins found to bind Rac1G15A (left). 14 proteins could be compared between wild type (Wt) and Tiam1–/– samples, 12 proteins in at least 2 out of 3 independent experiments (right). Wt/Tiam1–/– ratios are mean +/- SEM or range, as appropriate, of 2-3 independent experiments; coloured dots depict the different experiments. Statistics are one-way ANOVA with Dunnett’s multiple comparisons test on log-transformed ratios. (B) Total lysates from the experiments in (A) were western blotted with the indicated antibodies. Representative western blots and coomassie loading control are shown. Blots of selected proteins were quantified by densitometry (right). Wt/Tiam1–/– ratios are expressed as mean +/- SEM of 3 independent experiments; statistics are two-way ANOVA with Sidak’s multiple comparisons test on raw band intensities. Bottom panel: The Wt/Tiam1–/– Rac1G15A binding ratio is expressed as a function of the Wt/Tiam1–/– expression level for the indicated proteins. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38077328), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RAP1GDS1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RAP1GDS1
Alternate Names
Exchange factor smgGDS, GDS1, MGC118859, MGC118861, rap1 GTPase-GDP dissociation stimulator 1, RAP1, GTP-GDP dissociation stimulator 1, SMG GDS protein, SMG P21 stimulatory GDP/GTP exchange protein, SmgGDS
Gene Symbol
RAP1GDS1
Additional RAP1GDS1 Products
Product Documents for RAP1GDS1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAP1GDS1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RAP1GDS1 Antibody - BSA Free
Customer Reviews for RAP1GDS1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RAP1GDS1 Antibody - BSA Free and earn rewards!
Have you used RAP1GDS1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...