RBFOX3/NeuN Antibody (2F9F0)

Novus Biologicals | Catalog # NBP3-15656

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2F9F0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBFOX3/NeuN. MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBFOX3/NeuN Antibody (2F9F0)

RBFOX3/NeuN Antibody (2F9F0)

Western Blot: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Western Blot: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Western blot analysis of various lysates using RBFOX3/NeuN Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody (2F9F0) [NBP3-15656]

Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody (2F9F0) [NBP3-15656]

Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody (2F9F0) [NBP3-15656] - Immunohistochemistry of paraffin-embedded mouse brain using RBFOX3/NeuN Rabbit mAb (NBP3-15656) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
RBFOX3/NeuN Antibody (2F9F0)

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Immunohistochemistry analysis of paraffin-embedded Human brain tissue using RBFOX3/NeuN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
RBFOX3/NeuN Antibody (2F9F0)

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Confocal imaging of paraffin-embedded human brain tissue using RBFOX3/NeuN Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
RBFOX3/NeuN Antibody (2F9F0)

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Confocal imaging of paraffin-embedded rat brain tissue using RBFOX3/NeuN Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
RBFOX3/NeuN Antibody (2F9F0)

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Confocal imaging of paraffin-embedded mouse brain tissue using RBFOX3/NeuN Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
RBFOX3/NeuN Antibody (2F9F0)

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using RBFOX3/NeuN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
RBFOX3/NeuN Antibody (2F9F0)

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] -

Immunohistochemistry: RBFOX3/NeuN Antibody (2F9F0) [RBFOX3/NeuN] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using RBFOX3/NeuN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Applications for RBFOX3/NeuN Antibody (2F9F0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RBFOX3/NeuN

Rbfox3 (also known as Fox-3, Fox1 homolog C, Hrnbp3, and D11Bwg0517e) is one of three mammalian members of the RNA-binding protein Rbfox gene family, all of which are involved in regulating alternative RNA splicing. Originally identified as an epitope, NeuN is located within the N-terminal region (6-15 amino acids) of Rbfox3. Rbfox family members are highly conserved, having a single RNA recognition motif (RRM)-type RNA binding domain (RBD) near the center of the protein sequence. The RBD amino acid (aa) sequence is identical between members, Rbfox1 and Rbfox2, with 4 differences within the 77 aa domain of Rbfox3. The fox3 gene is comprised of 15 exons in humans, 11 exons in rat, with 3 variants in mouse containing 14 exons and another 3 variants containing 15 exons. The Rbfox3 protein is highly conserved across human, mouse, and rat with 98.9% sequence identity between mouse (isoform I) and rat and 83.9% sequence identity between mouse (isoform I) and human. The expression of Rbfox3/NeuN is restricted to the nervous system and has widely been used in stroke research. It is recognized as a marker of mature neuronal cell types in the spinal cord, cerebral cortex, hippocampus, dorsal thalamus, caudate/putamen, and cerebellum. NeuN has been shown to bind DNA and is predominantly nuclear. Differences in immunoreactivity have been reported between Rbfox3/NeuN subtypes in which the 46kDa is mainly found in the nucleus whereas the 48kDa form is primarily distributed in the cytoplasm (1,2).

Rbfox proteins participate in regulation of alternative splicing between family members as well as in autoregulation. While the breadth of brain and muscle specific targets for alternative splicing is well established for Rbfox proteins, those specific to Rbfox3/NeuN along with its alternative splicing mechanism are less understood. Rbfox3 has been shown to regulate neuronal differentiation by alternative splicing of Numb pre-mRNA and has a role in adult neurogenesis. Dysfunctional Rbfox3/NeuN has been associated with various neurological disorders such as neurodevelopmental delay, autism spectrum disorder, Benign rolandic epilepsy (BRE), and cognitive impairments (1,2).

References

1. Duan W, Zhang YP, Hou Z, Huang C, Zhu H, Zhang CQ, Yin Q. (2016) Novel Insights into NeuN: from Neuronal Marker to Splicing Regulator. Mol Neurobiol. 53(3):1637-1647. PMID: 25680637.

2. Su CH, D D, Tarn WY. (2018) Alternative Splicing in Neurogenesis and Brain Development. Front Mol Biosci. 5:12. PMID: 29484299

Long Name

RNA binding fox-1 homolog 3

Alternate Names

FOX-3, FOX3, HRNBP3, NEUN

Gene Symbol

RBFOX3

Additional RBFOX3/NeuN Products

Product Documents for RBFOX3/NeuN Antibody (2F9F0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBFOX3/NeuN Antibody (2F9F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBFOX3/NeuN Antibody (2F9F0)

There are currently no reviews for this product. Be the first to review RBFOX3/NeuN Antibody (2F9F0) and earn rewards!

Have you used RBFOX3/NeuN Antibody (2F9F0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...