Recombinant Human Active PDK-1 Protein, CF

R&D Systems | Catalog # 864-KS

R&D Systems
100% Guarantee

Key Product Details

  • R&D Systems Sf 9 (baculovirus)-derived Recombinant Human Active PDK-1 Protein (864-KS)
  • Quality control testing to verify active proteins with lot specific assays by in-house scientists
  • All R&D Systems proteins are covered with a 100% guarantee

Source

Sf 9 (baculovirus)

Accession Number

NM_002613

Applications

Bioactivity
View all PDK-1 Proteins and Enzymes »

Product Specifications

Source

Spodoptera frugiperda, Sf 9 (baculovirus)-derived human PDK-1 protein

Purity

>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.

N-terminal Sequence Analysis

Using an N-terminal His tag

SDS-PAGE

67 kDa

Activity

The specific activity of PDK-1 was determined to be 102 nmol/min/mg using a synthetic peptide substrate.

Scientific Data Images for Recombinant Human Active PDK-1 Protein, CF

Recombinant Human Active PDK-1 Protein SDS-PAGE

Recombinant Human Active PDK-1 Protein SDS-PAGE

The approximate molecular weight is 67 kDa and the purity is > 95%.

Formulation, Preparation, and Storage

864-KS
Formulation Supplied in 50 mM sodium phosphate (pH 7.0), 300 mM NaCl, 0.25 mM DTT, 150 mM imidazole, 0.1 mM PMSF, and 25% glycerol.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage This product is stable at ≤ ‑70°C for up to one year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: PDK-1

PDK-1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2 (1). PDK‑1 then activates protein kinase B (PKB) that, in turn, inactivates glycogen synthase kinase-3 (GSK-3). The phosphorylation of other proteins by PKB and GSK-3 is likely to mediate many of the intracellular actions of insulin. Thus, PDK‑1 plays a key role in mediating many of the actions of the second messenger(s) PtdIns(3,4,5)P3 and/or PtdIns(3,4)P2. Human PDK‑1 is a 556 amino acid residue monomeric enzyme comprised of a catalytic domain that is most similar to the PKA, PKB, and PKC subfamily of protein kinases.

References

  1. Cohen, P. et al. (1997) FEBS Letter 410:3.
  2. Alessi, D.R. et al. (1997) Current Biol. 7:261.

Long Name

Phosphoinositide Dependent Kinase-1

Alternate Names

PDK1, PDPK1, PKB kinase

Entrez Gene IDs

5170 (Human); 18607 (Mouse); 81745 (Rat)

Gene Symbol

PDPK1

UniProt

NM_002613 (Human)

Additional PDK-1 Products

Product Documents for Recombinant Human Active PDK-1 Protein, CF

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Download SDS

Product Specific Notices for Recombinant Human Active PDK-1 Protein, CF

For research use only

Citations for Recombinant Human Active PDK-1 Protein, CF

Customer Reviews for Recombinant Human Active PDK-1 Protein, CF

There are currently no reviews for this product. Be the first to review Recombinant Human Active PDK-1 Protein, CF and earn rewards!

Have you used Recombinant Human Active PDK-1 Protein, CF?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

View specific protocols for Recombinant Human Active PDK-1 Protein, CF (864-KS):

Materials
  • Active Kinase - Active PDK-1 (0.1 μg/μL) diluted with Kinase Dilution Buffer III. Note: These are suggested working dilutions. Optimal dilutions should be determined by each laboratory for each application.
  • Kinase Assay Buffer I - 25 mM MOPS, pH 7.2, 12.5 mM beta -glycerolphosphate, 25 mM MgCl2, 5 mM EGTA, 2 mM EDTA. Add 0.25 mM DTT to the Kinase Assay Buffer prior to use.
  • Kinase Dilution Buffer III - Kinase Assay Buffer I diluted at a 1:4 ratio (5-fold) with 50 ng/μL BSA solution.
  • 10 mM ATP Stock Solution - Prepare the ATP Stock Solution by dissolving 55 mg of ATP in 10 mL of Kinase Assay Buffer I. Store 200 μL aliquots at ≤ -20 °C.
  • [33P]-ATP Assay Cocktail - Prepare 250 μM [33P]-ATP Assay Cocktail in a designated radioactive work area by combining 150 μL of 10 mM ATP Stock Solution, 100 μL of [33P]-ATP (1 mCi/100 μL), and 5.75 mL of Kinase Assay Buffer I. Store 1 mL aliquots at ≤ -20° C.
  • Substrate - PDKtide synthetic peptide substrate (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) diluted in distilled or deionized water to a final concentration of 1.0 mg/mL.
  1. Thaw the [33P]-ATP Assay Cocktail in a shielded container in a designated radioactive work area.
  2. Thaw the Active PDK-1, Kinase Assay Buffer I, Substrate, and Kinase Dilution Buffer III on ice.
  3. In a pre-cooled microfuge tube, add the following reaction components bringing the initial reaction volume up to 20 μL:
    a. Diluted Active PDK-1: 10 μL
    b. Substrate (1.0 mg/mL; on ice): 5 μL
    c. Distilled or deionized water: 5.0 μL
  4. Set up the blank control as outlined in step 3, excluding the addition of the substrate. Replace the substrate with an equal volume of distilled or deionized water
  5. Initiate the reaction with the addition of 5 μL [33P]-ATP Assay Cocktail, bringing the final volume up to 25 μL. Incubate the mixture in a water bath at 30 °C for 15 minutes.
  6. After the 15 minute incubation, terminate the reaction by spotting 20 μL of the reaction mixture onto individual pre-cut strips of phosphocellulose P81 paper.
  7. Air dry the pre-cut P81 strip and sequentially wash in a 1% phosphoric acid solution (add 10 mL of phosphoric acid to 990 mL of distilled or deionized water) with constant gentle stirring. It is recommended that the strips be washed a total of three times for approximately 10 minutes each.
  8. Count the radioactivity on the P81 paper in the presence of scintillation fluid in a scintillation counter.
  9. Determine the corrected cpm by subtracting the blank control value (see step 4) for each sample and calculate the kinase specific activity as outlined below:


    Calculation of [33P]-ATP Specific Activity (SA) (cpm/pmol)
    Specific Activity (SA) = cpm for 5 μL [33P]-ATP/pmol of ATP (in 5 μL of a 250 μM ATP stock solution; i.e. 1250 pmol)

    Calculation of Kinase Specific Activity (SA) (pmol/minutes/μg or nmol/minutes/mg)
    Corrected cpm from reaction / [(SA of 33P-ATP in cpm/pmol) x (Reaction time in minutes) x (Enzyme amount in μg or mg)] x [(Reaction volume) / (Spot Volume)]

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes