Recombinant Human Active PDK-1 Protein, CF
R&D Systems | Catalog # 864-KS
Loading...
Key Product Details
- R&D Systems Sf 9 (baculovirus)-derived Recombinant Human Active PDK-1 Protein (864-KS)
- Quality control testing to verify active proteins with lot specific assays by in-house scientists
- All R&D Systems proteins are covered with a 100% guarantee
Source
Sf 9 (baculovirus)
Accession Number
Applications
Bioactivity
Loading...
Product Specifications
Source
Spodoptera frugiperda, Sf 9 (baculovirus)-derived human PDK-1 protein
Purity
>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.
N-terminal Sequence Analysis
Using an N-terminal His tag
SDS-PAGE
67 kDa
Activity
The specific activity of PDK-1 was determined to be 102 nmol/min/mg using a synthetic peptide substrate.
Scientific Data Images for Recombinant Human Active PDK-1 Protein, CF
Recombinant Human Active PDK-1 Protein SDS-PAGE
The approximate molecular weight is 67 kDa and the purity is > 95%.Formulation, Preparation, and Storage
864-KS
| Formulation | Supplied in 50 mM sodium phosphate (pH 7.0), 300 mM NaCl, 0.25 mM DTT, 150 mM imidazole, 0.1 mM PMSF, and 25% glycerol. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | This product is stable at ≤ ‑70°C for up to one year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles. |
Background: PDK-1
References
- Cohen, P. et al. (1997) FEBS Letter 410:3.
- Alessi, D.R. et al. (1997) Current Biol. 7:261.
Long Name
Phosphoinositide Dependent Kinase-1
Alternate Names
PDK1, PDPK1, PKB kinase
Gene Symbol
PDPK1
UniProt
Additional PDK-1 Products
Product Documents for Recombinant Human Active PDK-1 Protein, CF
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Note: Certificate of Analysis not available for kit components.
Product Specific Notices for Recombinant Human Active PDK-1 Protein, CF
For research use only
Related Research Areas
Citations for Recombinant Human Active PDK-1 Protein, CF
Customer Reviews for Recombinant Human Active PDK-1 Protein, CF
There are currently no reviews for this product. Be the first to review Recombinant Human Active PDK-1 Protein, CF and earn rewards!
Have you used Recombinant Human Active PDK-1 Protein, CF?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
View specific protocols for Recombinant Human Active PDK-1 Protein, CF (864-KS):
Materials
- Active Kinase - Active PDK-1 (0.1 μg/μL) diluted with Kinase Dilution Buffer III. Note: These are suggested working dilutions. Optimal dilutions should be determined by each laboratory for each application.
- Kinase Assay Buffer I - 25 mM MOPS, pH 7.2, 12.5 mM beta -glycerolphosphate, 25 mM MgCl2, 5 mM EGTA, 2 mM EDTA. Add 0.25 mM DTT to the Kinase Assay Buffer prior to use.
- Kinase Dilution Buffer III - Kinase Assay Buffer I diluted at a 1:4 ratio (5-fold) with 50 ng/μL BSA solution.
- 10 mM ATP Stock Solution - Prepare the ATP Stock Solution by dissolving 55 mg of ATP in 10 mL of Kinase Assay Buffer I. Store 200 μL aliquots at ≤ -20 °C.
- [33P]-ATP Assay Cocktail - Prepare 250 μM [33P]-ATP Assay Cocktail in a designated radioactive work area by combining 150 μL of 10 mM ATP Stock Solution, 100 μL of [33P]-ATP (1 mCi/100 μL), and 5.75 mL of Kinase Assay Buffer I. Store 1 mL aliquots at ≤ -20° C.
- Substrate - PDKtide synthetic peptide substrate ([protein fragment, 39 aa]) diluted in distilled or deionized water to a final concentration of 1.0 mg/mL.
- Thaw the [33P]-ATP Assay Cocktail in a shielded container in a designated radioactive work area.
- Thaw the Active PDK-1, Kinase Assay Buffer I, Substrate, and Kinase Dilution Buffer III on ice.
- In a pre-cooled microfuge tube, add the following reaction components bringing the initial reaction volume up to 20 μL:
a. Diluted Active PDK-1: 10 μL
b. Substrate (1.0 mg/mL; on ice): 5 μL
c. Distilled or deionized water: 5.0 μL - Set up the blank control as outlined in step 3, excluding the addition of the substrate. Replace the substrate with an equal volume of distilled or deionized water
- Initiate the reaction with the addition of 5 μL [33P]-ATP Assay Cocktail, bringing the final volume up to 25 μL. Incubate the mixture in a water bath at 30 °C for 15 minutes.
- After the 15 minute incubation, terminate the reaction by spotting 20 μL of the reaction mixture onto individual pre-cut strips of phosphocellulose P81 paper.
- Air dry the pre-cut P81 strip and sequentially wash in a 1% phosphoric acid solution (add 10 mL of phosphoric acid to 990 mL of distilled or deionized water) with constant gentle stirring. It is recommended that the strips be washed a total of three times for approximately 10 minutes each.
- Count the radioactivity on the P81 paper in the presence of scintillation fluid in a scintillation counter.
- Determine the corrected cpm by subtracting the blank control value (see step 4) for each sample and calculate the kinase specific activity as outlined below:
Calculation of [33P]-ATP Specific Activity (SA) (cpm/pmol)
Specific Activity (SA) = cpm for 5 μL [33P]-ATP/pmol of ATP (in 5 μL of a 250 μM ATP stock solution; i.e. 1250 pmol)
Calculation of Kinase Specific Activity (SA) (pmol/minutes/μg or nmol/minutes/mg)
Corrected cpm from reaction / [(SA of 33P-ATP in cpm/pmol) x (Reaction time in minutes) x (Enzyme amount in μg or mg)] x [(Reaction volume) / (Spot Volume)]
Loading...
Associated Pathways
IL-7 Signaling Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
mTOR Signaling Pathway
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways