REEP6 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-37919
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for REEP6 Antibody - BSA Free
Western Blot: REEP6 Antibody [NBP2-37919]
Western Blot: REEP6 Antibody [NBP2-37919] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissueImmunocytochemistry/ Immunofluorescence: REEP6 Antibody [NBP2-37919]
Immunocytochemistry/Immunofluorescence: REEP6 Antibody [NBP2-37919] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Analysis in human testis and skeletal muscle tissues using NBP2-37919 antibody. Corresponding REEP6 RNA-seq data are presented for the same tissues.Immunohistochemistry: REEP6 Antibody [NBP2-37919]
Immunohistochemistry: REEP6 Antibody [NBP2-37919] - Staining of human testis shows strong cytoplasmic and membranous positivity.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human duodenum shows high expression.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Applications for REEP6 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: REEP6
Alternate Names
C19orf32deleted in polyposis 1-like 1, DP1L1chromosome 19 open reading frame 32, FLJ25383, Polyposis locus protein 1-like 1, receptor accessory protein 6, receptor expression enhancing protein 6, receptor expression-enhancing protein 6, TB2L1
Gene Symbol
REEP6
UniProt
Additional REEP6 Products
Product Documents for REEP6 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for REEP6 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for REEP6 Antibody - BSA Free
Customer Reviews for REEP6 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review REEP6 Antibody - BSA Free and earn rewards!
Have you used REEP6 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...