REPIN1 Antibody (2X2E9)

Novus Biologicals | Catalog # NBP3-33519

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2X2E9
View all REPIN1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2).

Sequence:
SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for REPIN1 Antibody (2X2E9)

REPIN1 Antibody (2X2E9)

Western Blot:REPIN1 Antibody (2X2E9)-

Western Blot:REPIN1 Antibody (2X2E9)-Analysis of lysates from K-562 cells using REPIN1 Rabbit mAb at 1:40000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45s.
REPIN1 Antibody (2X2E9)

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-Human colon tissue using REPIN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
REPIN1 Antibody (2X2E9)

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-

Immunohistochemistry-Paraffin:REPIN1 Antibody (2X2E9)-Human colon carcinoma tissue using REPIN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
REPIN1 Antibody (2X2E9)

Western Blot: REPIN1 Antibody (2X2E9) [NBP3-33519] -

Western Blot: REPIN1 Antibody (2X2E9) [NBP3-33519] - Western Blot analysis of lysates from K-562 cells using REPIN1 Rabbit mAb at 1:40000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.

Applications for REPIN1 Antibody (2X2E9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:20000 - 1:80000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: REPIN1

REPIN1, also known as Replication initiator 1, is a 64kDa 567 amino acid protein that can be found in the nucleus. This gene is necessary for the process of initiating the chromosomal DNA replication. REPIN1 has been researched in relation to acrodermatitis enteropathica, enteropathica, acrodermatitis and immunodeficiency. REPIN1 has been linked to the synaptic transmission, cell proliferation, DNA replication, fatty acid transport and cell growth pathways where it interacts with GMNN, HDAC3, HDAC1, HDAC2 and GATA3.

Alternate Names

60 kDa origin-specific DNA-binding protein, 60 kDa replication initiation region protein, ATT-binding protein, DHFR oribeta-binding protein RIP60, H_DJ0584D14.12, replication initiation region protein (60kD), replication initiator 1, RIP60AP4, Zfp464, Zinc finger protein 464, zinc finger protein 464 (RIP60), zinc finger protein AP4, zinc finger proten AP4, ZNF464

Gene Symbol

REPIN1

Additional REPIN1 Products

Product Documents for REPIN1 Antibody (2X2E9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for REPIN1 Antibody (2X2E9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REPIN1 Antibody (2X2E9)

There are currently no reviews for this product. Be the first to review REPIN1 Antibody (2X2E9) and earn rewards!

Have you used REPIN1 Antibody (2X2E9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies