RFC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48927

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RFC4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RFC4 Antibody - BSA Free

Western Blot: RFC4 Antibody [NBP2-48927]

Western Blot: RFC4 Antibody [NBP2-48927]

Western Blot: RFC4 Antibody [NBP2-48927] - Analysis using Anti-RFC4 antibody NBP2-48927 (A) shows similar pattern to independent antibody NBP2-49283 (B).
Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP2-48927]

Immunocytochemistry/ Immunofluorescence: RFC4 Antibody [NBP2-48927]

Immunocytochemistry/Immunofluorescence: RFC4 Antibody [NBP2-48927] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927] - Staining in human testis and kidney tissues using anti-RFC4 antibody. Corresponding RFC4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927] - Staining of human Staining of human lymph node. shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927]

Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927] - Staining of human testis shows high expression.

Applications for RFC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFC4

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

A1, A1 37 kDa subunit, Activator 1 37 kDa subunit, Activator 1 subunit 4, MGC27291, replication factor C (activator 1) 4, 37kDa, Replication factor C 37 kDa subunit, replication factor C subunit 4, RFC 37 kDa subunit, RF-C 37 kDa subunit, RFC37replication factor C (activator 1) 4 (37kD)

Gene Symbol

RFC4

Additional RFC4 Products

Product Documents for RFC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RFC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFC4 Antibody - BSA Free and earn rewards!

Have you used RFC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies