RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Novus Biologicals | Catalog # H00148738-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1C12

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HFE2 (NP_973733, 93 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS

Specificity

HFE2 - hemochromatosis type 2 (juvenile) (1C12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Novus Biologicals Mouse RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free (H00148738-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-RGM-C/Hemojuvelin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Immunohistochemistry-Paraffin: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01]

Immunohistochemistry-Paraffin: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01]

Immunohistochemistry-Paraffin: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01] - Analysis of monoclonal antibody to HFE2 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Sandwich ELISA: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01] - Detection limit for recombinant GST tagged HFE2 is 3 ng/ml as a capture antibody.

Applications for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RGM-C/Hemojuvelin

The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq]

Long Name

Repulsive Guidance Molecule C

Alternate Names

DL-M, Hemojuvelin, HFE2, HJV, JH, RGMC

Entrez Gene IDs

148738 (Human)

Gene Symbol

HJV

Additional RGM-C/Hemojuvelin Products

Product Documents for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Customer Reviews for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free and earn rewards!

Have you used RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...