RhoC Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37976

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoC (NP_786886.1).

Sequence:
NIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RhoC Antibody - BSA Free

RhoC Antibody

Western Blot: RhoC Antibody [NBP3-37976] -

Western Blot: RhoC Antibody [NBP3-37976] - Western blot analysis of lysates from Rat heart, using RhoC Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
RhoC Antibody

Immunocytochemistry/ Immunofluorescence: RhoC Antibody [NBP3-37976] -

Immunocytochemistry/ Immunofluorescence: RhoC Antibody [NBP3-37976] - Immunofluorescence analysis of NIH/3T3 cells using RhoC Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RhoC Antibody

Western Blot: RhoC Antibody [NBP3-37976] -

Western Blot: RhoC Antibody [NBP3-37976] - Western blot analysis of lysates from A549 cells using RhoC Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 90 s.
RhoC Antibody

Western Blot: RhoC Antibody [NBP3-37976] -

Western Blot: RhoC Antibody [NBP3-37976] - Western Blot analysis of lysates from A549 cells using RhoC Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 90 s.

Applications for RhoC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RhoC

RhoC encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Alternate Names

ARH9ARHCRho cDNA clone 9, H9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC

Gene Symbol

RHOC

Additional RhoC Products

Product Documents for RhoC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RhoC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RhoC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RhoC Antibody - BSA Free and earn rewards!

Have you used RhoC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...