Rhot1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59021

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Cited:

Western Blot, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Miro1/Rhot1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26558789).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Rhot1 Antibody - BSA Free

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021]

Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021]

Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021] - HepG2 cell lysate, concentration 1.0ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021] - RHOT1 Antibody Titration: 2 ug/ml Positive Control: mouse brain/ human neuroblastoma cell line
Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021] - Antibody Titration: 1 ug/ml Human A549.
Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021]

Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Applications for Rhot1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Reviewed Applications

Read 4 reviews rated 4 using NBP1-59021 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Miro1/Rhot1

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Long Name

Mitochondrial Rho (MIRO) GTPase 1

Alternate Names

ARHT1, Rhot1

Entrez Gene IDs

55288 (Human); 59040 (Mouse); 511257 (Bovine); 417410 (Chicken)

Gene Symbol

RHOT1

UniProt

Q8IXI2

Additional Miro1/Rhot1 Products

Product Documents for Rhot1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rhot1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Rhot1 Antibody - BSA Free

Customer Reviews for Rhot1 Antibody - BSA Free (4)

4 out of 5
4 Customer Ratings
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Rhot1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 4 of 4 reviews Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: human whole cell lysates
    Species: Human
    Verified Customer | Posted 03/07/2016
    Rhot1 in human cell lysates
    Rhot1 Antibody - BSA Free NBP1-59021
  • Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Mouse lung sections paraffin embedded
    Species: Mouse
    Verified Customer | Posted 06/02/2015
    Rhot1 in mouse lung IHC
    Rhot1 Antibody - BSA Free NBP1-59021
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Mouse lung homogenates
    Species: Mouse
    Verified Customer | Posted 06/02/2015
    Rhot1 in mouse lung by WB
    Rhot1 Antibody - BSA Free NBP1-59021
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Lung homogenates
    Species: Human
    Verified Customer | Posted 05/29/2015
    Human Lung homogenates - Rhot1
    Rhot1 Antibody - BSA Free NBP1-59021

There are no reviews that match your criteria.

Showing  1 - 4 of 4 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies