RIAM/APBB1IP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39009

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RIAM/APBB1IP Antibody - BSA Free

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Analysis in human lymph node and heart muscle tissues. Corresponding RIAM/APBB1IP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex, colon, heart muscle and lymph node using Anti-RIAM/APBB1IP antibody NBP2-39009 (A) shows similar protein distribution across tissues to independent antibody NBP2-14300 (B).
Immunocytochemistry/ Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-39009]

Immunocytochemistry/ Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-39009]

Immunocytochemistry/Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-39009] - Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009]

Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.

Applications for RIAM/APBB1IP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RIAM/APBB1IP

Appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. Suppresses insulin-induced promoter activities through AP1 and SRE. Mediates Rap1-induced adhesion

Long Name

Amyloid Beta (A4) Precursor Protein-binding, Family B, Member 1 Interacting Protein

Alternate Names

APBB1-interacting protein 1, APBB1IP, INAG1, PREL1, RARP1

Gene Symbol

APBB1IP

UniProt

Additional RIAM/APBB1IP Products

Product Documents for RIAM/APBB1IP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RIAM/APBB1IP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for RIAM/APBB1IP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RIAM/APBB1IP Antibody - BSA Free and earn rewards!

Have you used RIAM/APBB1IP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...