Ribonuclease Inhibitor Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38074

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 202-461 of human Ribonuclease Inhibitor (NP_002930.2).

Sequence:
EALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDIYWSEEMEDRLQALEKDKPSLRVIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ribonuclease Inhibitor Antibody - BSA Free

Ribonuclease Inhibitor Antibody

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] -

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] - Immunofluorescence analysis of U-2 OS cells using Ribonuclease Inhibitor Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ribonuclease Inhibitor Antibody

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] -

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] - Immunofluorescence analysis of L929 cells using Ribonuclease Inhibitor Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ribonuclease Inhibitor Antibody

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] -

Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP3-38074] - Immunofluorescence analysis of C6 cells using Ribonuclease Inhibitor Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ribonuclease Inhibitor Antibody

Western Blot: Ribonuclease Inhibitor Antibody [NBP3-38074] -

Western Blot: Ribonuclease Inhibitor Antibody [NBP3-38074] - Western blot analysis of various lysates using Ribonuclease Inhibitor Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for Ribonuclease Inhibitor Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ribonuclease Inhibitor

Inhibitor of pancreatic RNase and angiogenin. May also function in the modulation of cellular activities

Alternate Names

Placental ribonuclease inhibitor, Placental RNase inhibitor, PRI, RAIMGC4569, ribonuclease inhibitor, ribonuclease/angiogenin inhibitor, ribonuclease/angiogenin inhibitor 1MGC18200, RNHMGC54054

Gene Symbol

RNH1

Additional Ribonuclease Inhibitor Products

Product Documents for Ribonuclease Inhibitor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ribonuclease Inhibitor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ribonuclease Inhibitor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ribonuclease Inhibitor Antibody - BSA Free and earn rewards!

Have you used Ribonuclease Inhibitor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...