RNA Helicase A Antibody (2I6C5)

Novus Biologicals | Catalog # NBP3-16435

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2I6C5 expressed in HEK293
View all RNA Helicase A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human RNA Helicase A (Q08211). ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

141 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RNA Helicase A Antibody (2I6C5)

Western Blot: RNA Helicase A Antibody (2I6C5) [NBP3-16435]

Western Blot: RNA Helicase A Antibody (2I6C5) [NBP3-16435]

Western Blot: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Western blot analysis of extracts of various cell lines, using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: RNA Helicase A Antibody (2I6C5) [NBP3-16435]

Immunoprecipitation: RNA Helicase A Antibody (2I6C5) [NBP3-16435]

Immunoprecipitation: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug DHX9/RNA Helicase A antibody (NBP3-16435). Western blot was performed from the immunoprecipitate using DHX9/RNA Helicase A antibody (NBP3-16435) at a dilition of 1:2000.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Rat brain using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Rat testis using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunocytochemistry/ Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunocytochemistry/ Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Confocal imaging of U-2 OS cells using RNA Helicase A Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Human placenta using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Human colon using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RNA Helicase A Antibody (2I6C5)

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] -

Immunohistochemistry: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry analysis of paraffin-embedded Rat liver using RNA Helicase A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for RNA Helicase A Antibody (2I6C5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RNA Helicase A

DHX9, also known as ATP-dependent RNA helicase A, consists of a 141 kDa and a 24.3 kDa isoform and is involved in activating transcription and unwinding DNA and RNA helixes in the 3' to 5' direction. Current research is being conducted on diseases and disorders such as influenza, hepatitis, t-cell leukemia, astigmatism, keratitis, immunodeficiency, Werner syndrome, and arthritis. The protein interacts in mRNA splicing, mRNA processing, and gene expression pathways with HIST1H3A- HIST13E proteins.

Long Name

ATP-dependent RNA helicase A

Alternate Names

DDX9, DEAH box protein 9, DExH-box helicase 9, DHX9, EC 3.6.4.13, Leukophysin, LKP, NDH II, NDH2

Gene Symbol

DHX9

Additional RNA Helicase A Products

Product Documents for RNA Helicase A Antibody (2I6C5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNA Helicase A Antibody (2I6C5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNA Helicase A Antibody (2I6C5)

There are currently no reviews for this product. Be the first to review RNA Helicase A Antibody (2I6C5) and earn rewards!

Have you used RNA Helicase A Antibody (2I6C5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies