RNF12 Antibody (1G10) - Azide and BSA Free

Novus Biologicals | Catalog # H00051132-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1G10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27788132).

Localization

Cytoplasmic and Nuclear

Specificity

RNF12 - ring finger protein 12

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for RNF12 Antibody (1G10) - Azide and BSA Free

Western Blot: RNF12 Antibody (1G10) [H00051132-M01]

Western Blot: RNF12 Antibody (1G10) [H00051132-M01]

Western Blot: RNF12 Antibody (1G10) [H00051132-M01] - RNF12 monoclonal antibody (M01), clone 1G10. Analysis of RNF12 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: RNF12 Antibody (1G10) [H00051132-M01]

Immunocytochemistry/ Immunofluorescence: RNF12 Antibody (1G10) [H00051132-M01]

Immunocytochemistry/Immunofluorescence: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of monoclonal antibody to RNF12 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: RNF12 Antibody (1G10) [H00051132-M01]

Western Blot: RNF12 Antibody (1G10) [H00051132-M01]

Western Blot: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody (M01), clone 1G10.Lane 1: RNF12 transfected lysate (Predicted MW: 68.5 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: RNF12 Antibody (1G10) [H00051132-M01]

Immunoprecipitation: RNF12 Antibody (1G10) [H00051132-M01]

Immunoprecipitation: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of RNF12 transfected lysate using anti-RNF12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF12 MaxPab rabbit polyclonal antibody.
ELISA: RNF12 Antibody (1G10) [H00051132-M01]

ELISA: RNF12 Antibody (1G10) [H00051132-M01]

ELISA: RNF12 Antibody (1G10) [H00051132-M01] - Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody.
RNF12 Antibody (1G10) - Azide and BSA Free

Western Blot: RNF12 Antibody (1G10) - Azide and BSA Free [H00051132-M01] -

RNF12 TurboID proximity labelling identifies chromatin-associated proteins.(A)Rlim+/y mouse embryonic stem cells (mESCs) stably overexpressing HA-TurboID RNF12 and HA-TurboID control were treated with MG132, doxycycline, and biotin in triplicate. Levels of HA-TurboID RNF12 and HA-TurboID control were determined by immunoblotting and indicated by an asterisk. ERK1/2 is shown as a loading control. (B) Immunofluorescence analysis of doxycycline and biotin-treated Rlim+/y mESCs stably overexpressing HA-TurboID RNF12 and HA-TurboID control. HA, total RNF12, and Hoechst as a nuclear stain are shown. (C) Volcano plot showing relative change in protein abundance of biotinylated proteins comparing MG132, doxycycline, and biotin-treated Rlim+/y mESCs stably overexpressing HA-TurboID RNF12 to HA-TurboID control. Red data points indicate proteins displaying a >twofold increase in intensity in HA-TurboID RNF12-expressing mESCs. (D) Database for Annotation, Visualization, and Integrated Discovery analysis showing enriched biological processes within the gene set encoding proteins with annotated nuclear localisation and/or function and which display >twofold increased intensity in HA-TurboID RNF12-overexpressing cells compared with control. (E) Venn diagram displaying the number of proteins identified to have >twofold increase in intensity in HA-TurboID RNF12-overexpressing cells relative to control, compared with the number of RNF12-interacting proteins identified by affinity-purification mass spectrometry (Gontan et al, 2012). Proteins common to both datasets are indicated.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38199845), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RNF12 Antibody (1G10) - Azide and BSA Free

Western Blot: RNF12 Antibody (1G10) - Azide and BSA Free [H00051132-M01] -

RNF12 chromatin recruitment is required for target gene transcription.(A)Rlim+/y mouse embryonic stem cells (mESCs) expressing HA-tagged mouse RNF12WT, RNF12 delta BR, RNF12W576Y, and RNF12 delta BR2 and differentiated for 72 h. Xist RNA levels were normalized to Gapdh and represented as fold-change relative to RNF12WT. Data represented as mean +/- SEM (n = 5). Statistical significance was determined by paired t test; two-sided, confidence level 95%. (B)Rlim+/y mouse embryonic stem cells expressing HA-tagged mouse RNF12WT, HA-RNF12 delta BR, HA-RNF12W576Y, and HA-RNF12 delta BR2 were lysed, and total RNF12, HA-RNF12, and REX1 levels determined by immunoblotting. Ponceau staining is shown as a control. Data are representative of n = 5 independent experiments. (C) Model for how chromatin functions as an RNF12 regulatory platform. N-term = RNF12 N-terminal sequences. RNF12 recruitment to chromatin is mediated by the RNF12 BR, which is required for efficient REX1 ubiquitylation and regulation of RNF12-dependent genes. In an opposing manner, RNF12 N-terminal sequences supress chromatin recruitment and substrate ubiquitylation, conferring a previously unappreciated autoinhibitory mechanism. Note that the RNF12 BR is also involved in direct regulation of catalytic activity.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38199845), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RNF12 Antibody (1G10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RNF12

The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

DKFZp686N06224, E3 ubiquitin-protein ligase RLIM, E3 ubiquitin-protein ligase RNF12, EC 6.3.2, EC 6.3.2.-, FLJ25923, FLJ41093, LIM domain-interacting RING finger protein, MGC15161, NY-REN-43, Renal carcinoma antigen NY-REN-43, RING finger LIM domain-binding protein, RING finger protein 12FLJ42887, ring finger protein, LIM domain interacting, ring zinc finger LIM domain binding protein, ring zinc finger protein NY-REN-43antigen, R-LIM, RNF12FLJ45986

Entrez Gene IDs

51132 (Human)

Gene Symbol

RLIM

OMIM

300379 (Human)

Additional RNF12 Products

Product Documents for RNF12 Antibody (1G10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF12 Antibody (1G10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RNF12 Antibody (1G10) - Azide and BSA Free

Customer Reviews for RNF12 Antibody (1G10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNF12 Antibody (1G10) - Azide and BSA Free and earn rewards!

Have you used RNF12 Antibody (1G10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...