Ropporin 1-like Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47299

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ropporin 1-like Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ropporin 1-like Antibody - BSA Free

Western Blot: Ropporin 1-like Antibody [NBP2-47299]

Western Blot: Ropporin 1-like Antibody [NBP2-47299]

Western Blot: Ropporin 1-like Antibody [NBP2-47299] - Analysis in control (vector only transfected HEK293T lysate) and ROPN1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining in human testis and prostate tissues using NBP2-47299 antibody. Corresponding ROPN1L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human bronchus, fallopian tube, liver and testis using Anti-ROPN1L antibody NBP2-47299 (A) shows similar protein distribution across tissues to independent antibody NBP1-90081 (B).
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299]

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP2-47299] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for Ropporin 1-like Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ropporin 1-like

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Alternate Names

AKAP-associated sperm protein, ASPFLJ23003, FLJ25776, radial spoke head 11 homolog, rhophilin associated tail protein 1-like, ROPN1-like protein, ropporin 1-like, ropporin-1-like protein, RSPH11

Gene Symbol

ROPN1L

Additional Ropporin 1-like Products

Product Documents for Ropporin 1-like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ropporin 1-like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ropporin 1-like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ropporin 1-like Antibody - BSA Free and earn rewards!

Have you used Ropporin 1-like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies