ROR alpha/NR1F1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52828

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ROR alpha/NR1F1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RORA (NP_599022). Peptide sequence GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ROR alpha/NR1F1 Antibody - BSA Free

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Immunohistochemistry-Paraffin: ROR alpha/NR1F1 Antibody [NBP1-52828]

Immunohistochemistry-Paraffin: ROR alpha/NR1F1 Antibody [NBP1-52828]

Immunohistochemistry-Paraffin: ROR alpha/NR1F1 Antibody [NBP1-52828] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52828] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml

Applications for ROR alpha/NR1F1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ROR alpha/NR1F1

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Long Name

Retinoic Acid-Related Orphan Receptor alpha

Alternate Names

NR1F1, RORA, RZRA

Entrez Gene IDs

6095 (Human)

Gene Symbol

RORA

UniProt

P35398

Additional ROR alpha/NR1F1 Products

Product Documents for ROR alpha/NR1F1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ROR alpha/NR1F1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ROR alpha/NR1F1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ROR alpha/NR1F1 Antibody - BSA Free and earn rewards!

Have you used ROR alpha/NR1F1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies