RPL28 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13254

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RPL28 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL28 Antibody - BSA Free

Western Blot: RPL28 Antibody [NBP2-13254]

Western Blot: RPL28 Antibody [NBP2-13254]

Western Blot: RPL28 Antibody [NBP2-13254] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: RPL28 Antibody [NBP2-13254]

Immunocytochemistry/ Immunofluorescence: RPL28 Antibody [NBP2-13254]

Immunocytochemistry/Immunofluorescence: RPL28 Antibody [NBP2-13254] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254]

Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
RPL28 Antibody - BSA Free Western Blot: RPL28 Antibody - BSA Free [NBP2-13254]

Western Blot: RPL28 Antibody - BSA Free [NBP2-13254]

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Applications for RPL28 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 1 using NBP2-13254 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL28

RPL28 - ribosomal protein L28

Alternate Names

FLJ43307,60S ribosomal protein L28, ribosomal protein L28

Gene Symbol

RPL28

Additional RPL28 Products

Product Documents for RPL28 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPL28 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL28 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used RPL28 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • RPL28 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: human brain lysate
    Species: Human
    Verified Customer | Posted 04/06/2023
    RPL28 Antibodies NBP2-13254, ProteinSimple Western Blot on Jess Instrument; 3 and 1 microgram of human brain tissue lysate was tested with the antibodies diluted 10 times. No specific signal was detected at any exposure.
    RPL28 Antibody - BSA Free NBP2-13254
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies