RPL3L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13257

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL3L Antibody - BSA Free

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257]

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257]

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Analysis in human skeletal muscle and prostate tissues using NBP2-13257 antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: RPL3L Antibody [NBP2-13257]

Immunocytochemistry/ Immunofluorescence: RPL3L Antibody [NBP2-13257]

Immunocytochemistry/Immunofluorescence: RPL3L Antibody [NBP2-13257] - Staining of human cell line PC-3 shows localization to nuclear speckles.
RPL3L Antibody - BSA Free Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
RPL3L Antibody - BSA Free Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Analysis in human skeletal muscle and prostate tissues using NBP2-13257 antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.
RPL3L Antibody - BSA Free Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.
RPL3L Antibody - BSA Free Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Staining of human prostate shows no cytoplasmic positivity in glandular cells as expected.
RPL3L Antibody - BSA Free Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Immunohistochemistry: RPL3L Antibody - BSA Free [NBP2-13257]

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Applications for RPL3L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL3L

The RPL3L gene encodes a protein that shares sequence similarity with ribosomal protein L3. The protein belongs to the L3P family of ribosomal proteins. Unlike the ubiquitous expression of ribosomal protein genes, this gene has a tissue-specific pattern of exp

Alternate Names

60S ribosomal protein L3-like, ribosomal protein L3-like

Gene Symbol

RPL3L

Additional RPL3L Products

Product Documents for RPL3L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL3L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL3L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL3L Antibody - BSA Free and earn rewards!

Have you used RPL3L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...