RPP25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92349

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPP25 Antibody - BSA Free

Western Blot: RPP25 Antibody [NBP1-92349]

Western Blot: RPP25 Antibody [NBP1-92349]

Western Blot: RPP25 Antibody [NBP1-92349] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line SK-MEL-30
Immunocytochemistry/ Immunofluorescence: RPP25 Antibody [NBP1-92349]

Immunocytochemistry/ Immunofluorescence: RPP25 Antibody [NBP1-92349]

Immunocytochemistry/Immunofluorescence: RPP25 Antibody [NBP1-92349] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & microtubule organizing center.
Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349] - Staining of human testis shows moderate nuclear positivity in Leydig cells.
Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349] - Staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349]

Immunohistochemistry-Paraffin: RPP25 Antibody [NBP1-92349] - Staining of human skeletal muscle shows no nuclear positivity in myocytes.
RPP25 Antibody - BSA Free Immunohistochemistry: RPP25 Antibody - BSA Free [NBP1-92349]

Immunohistochemistry: RPP25 Antibody - BSA Free [NBP1-92349]

Staining of human colon shows moderate nuclear positivity in glandular cells.
RPP25 Antibody - BSA Free Western Blot: RPP25 Antibody - BSA Free [NBP1-92349]

Western Blot: RPP25 Antibody - BSA Free [NBP1-92349]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line SK-MEL-30

Applications for RPP25 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPP25

RPP25 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP. This subunit binds to RNA

Alternate Names

FLJ20374, ribonuclease P 25kDa subunit, ribonuclease P protein subunit p25, ribonuclease P/MRP 25kDa subunit, RNase P protein subunit p25

Gene Symbol

RPP25

Additional RPP25 Products

Product Documents for RPP25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPP25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPP25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPP25 Antibody - BSA Free and earn rewards!

Have you used RPP25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...