S100A6 Antibody (0J1Q5)

Novus Biologicals | Catalog # NBP3-16191

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0J1Q5 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (P06703). MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for S100A6 Antibody (0J1Q5)

Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191]

Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191]

Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191]

Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191]

Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191]

Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191]

Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Human liver using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191]

Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191]

Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Rat spleen using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
S100A6 Antibody (0J1Q5)

Immunocytochemistry/ Immunofluorescence: S100A6 Antibody (0J1Q5) [NBP3-16191] -

Immunocytochemistry/ Immunofluorescence: S100A6 Antibody (0J1Q5) [NBP3-16191] - Confocal imaging of C2C12 cells using S100A6 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for S100A6 Antibody (0J1Q5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: S100A6

S100A6 is a member of the S100 family of proteins, and may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Recent studies have found that S100A6 is induced by tumour necrosis factor-alpha via a NF-kappaB-dependent mechanism, which serves a role in limiting tumour necrosis factor-alpha-induced apoptosis by regulating p53 phosphorylation.

Long Name

S100 Calcium Binding Protein A6

Alternate Names

CACY, MLN 4, PRA

Gene Symbol

S100A6

Additional S100A6 Products

Product Documents for S100A6 Antibody (0J1Q5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A6 Antibody (0J1Q5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S100A6 Antibody (0J1Q5)

There are currently no reviews for this product. Be the first to review S100A6 Antibody (0J1Q5) and earn rewards!

Have you used S100A6 Antibody (0J1Q5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...