S100B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87102

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26133460). Mouse reactivity reported in scientific literature (25176044).

Marker

Astrocyte Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit S100B Antibody - BSA Free (NBP1-87102) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-S100B Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for S100B Antibody - BSA Free

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Analysis in human cerebral cortex and liver tissues. Corresponding S100B RNA-seq data are presented for the same tissues.
Western Blot: S100B Antibody [NBP1-87102]

Western Blot: S100B Antibody [NBP1-87102]

Western Blot: S100B Antibody [NBP1-87102] - Analysis in mouse cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: S100B Antibody [NBP1-87102]

Immunocytochemistry/ Immunofluorescence: S100B Antibody [NBP1-87102]

Immunocytochemistry/Immunofluorescence: S100B Antibody [NBP1-87102] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining Is shown in green.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebellum shows moderate to strong nuclear positivity in cells in purkinje cell layer.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102]

Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for S100B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100B

S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).

References

1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.

2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427

3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3

4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089

Long Name

S100 Calcium Binding Protein B

Alternate Names

beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta

Gene Symbol

S100B

Additional S100B Products

Product Documents for S100B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for S100B Antibody - BSA Free

Customer Reviews for S100B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100B Antibody - BSA Free and earn rewards!

Have you used S100B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies