SAM68 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38645

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SAM68 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SAM68 Antibody - BSA Free (NBP2-38645) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SAM68 Antibody - BSA Free

Western Blot: SAM68 Antibody [NBP2-38645]

Western Blot: SAM68 Antibody [NBP2-38645]

Western Blot: SAM68 Antibody [NBP2-38645] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-KHDRBS1 antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: SAM68 Antibody [NBP2-38645]

Immunocytochemistry/ Immunofluorescence: SAM68 Antibody [NBP2-38645]

Immunocytochemistry/Immunofluorescence: SAM68 Antibody [NBP2-38645] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645] - Staining in human endometrium and skeletal muscle tissues using anti-KHDRBS1 antibody. Corresponding KHDRBS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: SAM68 Antibody [NBP2-38645]

Immunohistochemistry: SAM68 Antibody [NBP2-38645]

Immunohistochemistry: SAM68 Antibody [NBP2-38645] - Staining of human cerebral cortex shows strong nuclear positivity in both neuronal cells and glial cells.
Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645]

Immunohistochemistry-Paraffin: SAM68 Antibody [NBP2-38645] - Staining of human skeletal muscle shows low expression as expected.

Applications for SAM68 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAM68

Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. Role in G2-M progression in the cell cycle. Represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. Also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export Function: Isoform 3, which is expressed in growth-arrested cells only, inhibits S phase

Long Name

Src-associated in Mitosis 68 kDa Protein

Alternate Names

KHDRBS1, p62, p68

Gene Symbol

KHDRBS1

UniProt

Q07666

Additional SAM68 Products

Product Documents for SAM68 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SAM68 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAM68 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAM68 Antibody - BSA Free and earn rewards!

Have you used SAM68 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies