SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-90967

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

SARS-CoV, SARS-CoV-2

Cited:

Virus - SARS-CoV-2

Applications

Validated:

Western Blot, ELISA, Immunoassay, Direct ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

ELISA, Immunoassay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG Clone # AP201054

Format

Azide and BSA Free
View all SARS Nucleocapsid Protein Primary Antibodies »

Product Specifications

Immunogen

The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG

Applications for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000
Application Notes
Use in Immunoassay reported in scientific literature (PMID:34944502)..

Formulation, Preparation, and Storage

Purification

Protein G purified

Reconstitution

Reconstitute with sterilized PBS to a final concentration of 0.5 mg/ml.

Formulation

Lyophilized from a 0.2 um filtered solution in PBS.

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

LYOPH mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Calculators

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: SARS Nucleocapsid Protein

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Alternate Names

N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome, COVID-19 nucleocapsid protein, SARSCOV2 N protein, SARS-COV-2 nucleocapsid protein, SARS-COV-2 Nucleoprotein

Gene Symbol

N

Additional SARS Nucleocapsid Protein Products

Product Documents for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

Customer Reviews for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free and earn rewards!

Have you used SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies