SDC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56049

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SDC3 Antibody - BSA Free

Western Blot: SDC3 Antibody [NBP2-56049]

Western Blot: SDC3 Antibody [NBP2-56049]

Western Blot: SDC3 Antibody [NBP2-56049] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: SDC3 Antibody [NBP2-56049]

Immunocytochemistry/ Immunofluorescence: SDC3 Antibody [NBP2-56049]

Immunocytochemistry/Immunofluorescence: SDC3 Antibody [NBP2-56049] - Staining of human cell line A-431 shows localization to nuclear speckles & mitochondria.

Applications for SDC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syndecan-3

Syndecans are type 1 transmembrane proteoglycans that constitute the major physiological form of heparan sulfate (HS) on the cell surface. The four vertebrate syndecans, Syndecan-1 through -4, have similar short cytoplasmic domains and extracellular portions that diverge, except for HS attachment sites. Structurally diverse side chains add considerably to the size of the core proteins and serve as binding sites for growth factors, cytokines, and extracellular matrix proteins. Syndecans are present as homodimers or multimers, and are often expressed in developmental and cell type-specific patterns. They have many biological roles including regulating cell growth, differentiation, and adhesion.

Alternate Names

N-Syndecan, SDC3, Syndecan3

Gene Symbol

SDC3

Additional Syndecan-3 Products

Product Documents for SDC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SDC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SDC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SDC3 Antibody - BSA Free and earn rewards!

Have you used SDC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies