SDHAF4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86324
Loading...
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCID
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SDHAF4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SDHAF4 Antibody [NBP1-86324]
Immunocytochemistry/Immunofluorescence: SDHAF4 Antibody [NBP1-86324] - Staining of human cell line A-431 shows localization to nucleus & mitochondria. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324]
Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324]
Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324]
Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324]
Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.Western Blot: SDHAF4 Antibody - BSA Free [NBP1-86324]
Analysis in control (vector only transfected HEK293T lysate) and C6orf57 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Western Blot: SDHAF4 Antibody - BSA Free [NBP1-86324] -
Structure of the SDHA-AF2-AF4 complex.a Ribbon diagram of the human SDHA-AF2-AF4 complex. SDHA is shown in gray, SDHAF2 is shown in cyan, and SDHAF4 is shown in orange. The covalent FAD is shown as a stick representation with carbons yellow, oxygens red, nitrogens blue, and phosphorous orange. The isoalloxazine functional group of the FAD is positioned between the flavin-binding domain of SDHA and the C-terminus of SDHAF4. Key interactions are shown in the inset. b Orientation of SDHAF2 and SDHAF4 in the complex. SDHA is shown as ribbons and SDHAF2 and SDHAF4 are shown as space-filling. The view is rotated 70 around the x-axis as compared to the view in (a). c Interactions between the C-terminus of SDHAF4 and the SDHA active site. The position of the conserved C-terminus is stabilized by interactions between SDHAF4D107 and SDHAF4F108 and SDHA active site residues SDHAR451 and SDHAH407. d Validation of SDHAF4 binding residues using mutagenesis. SDHAF4 containing the indicated C-terminal mutations was evaluated for the ability to displace SDHAF2 from the SDHA-AF2 complex. The assembly factors that remained bound to SDHA were visualized after the separation of the reaction on an SDS-PAGE gel. Mutations involved SDHAF4D107 (SDHAF4D107A, SDHAF4D107T and SDHAF4D107N), and SDHAF4F108 (SDHAF4F108A and SDHAF4 delta F108). The SDS-PAGE gel is representative of n = 4 independent experiments. ImageJ quantitation of SDHAF2 (teal) and SDHAF4 (brown) was used to calculate the percentage of each assembly bound to SDHA, as compared to a control (100%). This is expressed on the y-axis of each bar graph as mean values +/- SD. Bar graphs show mean values +/- SD, and statistics were calculated by paired two-tailed Student’s t-test. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41467-023-44563-7), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SDHAF4 Antibody - BSA Free [NBP1-86324] -
Pairwise interactions between SDHA, SDHAF2, and SDHAF4.The interaction of His-SDHA (2.6 uM) with SDHAF2 (6.4 uM) and SDHAF4 (8 uM) was evaluated by using a Ni-NTA pull-down assay. SDHA was tested in several of its forms: apo-SDHA, SDHA with bound non-covalent FAD, and holo-SDHA with covalently attached FAD. His6-SDHA was incubated with purified SDHAF2 and SDHAF4 as indicated and associated proteins were evaluated by SDS-PAGE. FAD was added at 75 uM and fumarate was added at 5 mM. Yellowish FAD fluorescence is observed when SDHA is covalently attached to FAD. ImageJ densitometry, shown at the bottom, was measured as arbitrary units (arb. units.) and used to evaluate the relative binding of SDHAF2 (teal) and SDHAF4 (brown) to SDHA. The y-axis on the densitometry quantitation expresses these as a ratio. a Input protein and pairwise interaction between SDHA and SDHAF2. (left) input SDHA, (right) interaction between SDHA and SDHAF2 in the presence of FAD and fumarate. Note that only after the addition of fumarate does the covalent bond between FAD and SDHA form (lane 3). b Pairwise interaction of SDHA and SDHAF4. c Interaction of SDHA with the assembly factors after incubation with both SDHAF2 and SDHAF4. d Displacement of SDHAF2 after purified holo-SDHA/SDHAF2 complex (2 uM) was incubated with SDHAF4. All Coomassie gels are representative of n = 4 independent experiments, bar graphs show mean values +/- SD, and statistics were done by paired two-tailed Student’s t-test. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41467-023-44563-7), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SDHAF4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SDHAF4
Alternate Names
chromosome 6 open reading frame 57, hypothetical protein LOC135154, MGC104225
Gene Symbol
C6ORF57
Additional SDHAF4 Products
Product Documents for SDHAF4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SDHAF4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SDHAF4 Antibody - BSA Free
Customer Reviews for SDHAF4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SDHAF4 Antibody - BSA Free and earn rewards!
Have you used SDHAF4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...