Septin-10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56906

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Septin-10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-10 Antibody - BSA Free

Western Blot: Septin-10 Antibody [NBP2-56906]

Western Blot: Septin-10 Antibody [NBP2-56906]

Western Blot: Septin-10 Antibody [NBP2-56906] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Septin-10 Antibody [NBP2-56906]

Immunocytochemistry/ Immunofluorescence: Septin-10 Antibody [NBP2-56906]

Immunocytochemistry/Immunofluorescence: Septin-10 Antibody [NBP2-56906] - Staining of human cell line A-431 shows localization to actin filaments.
Western Blot: Septin-10 Antibody [NBP2-56906]

Western Blot: Septin-10 Antibody [NBP2-56906]

Western Blot: Septin-10 Antibody [NBP2-56906] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Applications for Septin-10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Septin-10

This gene encodes a member of the septin family of cytoskeletal proteins with GTPase activity. This protein localizes to the cytoplasm and nucleus and displays GTP-binding and GTPase activity. Alternate splicing results in two transcript variants encoding different isoforms.

Alternate Names

FLJ11619, septin 10, septin-10

Gene Symbol

SEPT10

Additional Septin-10 Products

Product Documents for Septin-10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Septin-10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Septin-10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Septin-10 Antibody - BSA Free and earn rewards!

Have you used Septin-10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies