SERCA2 ATPase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34147

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERCA2 ATPase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SERCA2 ATPase Antibody - BSA Free

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147] - Staining in human skeletal muscle and kidney tissues using anti-ATP2A2 antibody. Corresponding ATP2A2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: SERCA2 ATPase Antibody [NBP2-34147]

Immunocytochemistry/ Immunofluorescence: SERCA2 ATPase Antibody [NBP2-34147]

Immunocytochemistry/Immunofluorescence: SERCA2 ATPase Antibody [NBP2-34147] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147]

Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147] - Staining of human kidney shows low expression as expected.

Applications for SERCA2 ATPase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERCA2 ATPase

Sarcoplasmic/endoplasmic reticulum Calcium-ATPase 2 (SERCA2) is a magnesium-dependent pump that catalyzes the hydrolysis of ATP and translocates calcium from the cytosol to the sarcoplasmic reticulum lumen. There are 2 SERCA2 isoforms that differ in the 3' UTR. The SERCA2A isoform is highly expressed in heart and slow twitch skeletal muscle and is important to the regulation of the contraction and relaxation cycle, while the SERCA2B isoform is expressed in smooth muscle and adult epidermis. SERCA2 is also known as ATP2A2, ATP2B, DAR, DD, and MGC45367.

Long Name

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Alternate Names

ATP2A2, ATP2B, Calcium pump 2, SERCA2, SR Ca(2+)-ATPase 2

Gene Symbol

ATP2A2

UniProt

P16615 (Human)

Additional SERCA2 ATPase Products

Product Documents for SERCA2 ATPase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERCA2 ATPase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SERCA2 ATPase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERCA2 ATPase Antibody - BSA Free and earn rewards!

Have you used SERCA2 ATPase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies