SERPINB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49056

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERPINB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVN

Reactivity Notes

Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SERPINB1 Antibody - BSA Free

Western Blot: SERPINB1 Antibody [NBP2-49056]

Western Blot: SERPINB1 Antibody [NBP2-49056]

Western Blot: SERPINB1 Antibody [NBP2-49056] - Analysis using Anti-SERPINB1 antibody NBP2-49056 (A) shows similar pattern to independent antibody NBP1-89072 (B).
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human kidney.
Western Blot: SERPINB1 Antibody [NBP2-49056]

Western Blot: SERPINB1 Antibody [NBP2-49056]

Western Blot: SERPINB1 Antibody [NBP2-49056] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
Immunohistochemistry: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining in human esophagus and cerebral cortex tissues using anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow, kidney, liver and testis using Anti-SERPINB1 antibody NBP2-49056 (A) shows similar protein distribution across tissues to independent antibody NBP1-89072 (B).
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human testis.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056]

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human liver.

Applications for SERPINB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERPINB1

Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase,chymotrypsin, and kallikrein-3

Alternate Names

EILEI, ELANH2MNEI, elastase, leukocyte elastase inhibitor, Monocyte/neutrophil elastase inhibitor, Peptidase inhibitor 2, PI-2, PI2M/NEI, protease inhibitor 2 (elastase), monocyte/neutrophil derived, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1, Serpin B1, serpin peptidase inhibitor, clade B (ovalbumin), member 1

Gene Symbol

SERPINB1

Additional SERPINB1 Products

Product Documents for SERPINB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERPINB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SERPINB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERPINB1 Antibody - BSA Free and earn rewards!

Have you used SERPINB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies