SF20/MYDGF Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48856

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Reactivity Notes

Rat (89%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SF20/MYDGF Antibody - BSA Free

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856] - Analysis in human prostate and skeletal muscle tissues. Corresponding SF20/MYDGF RNA-seq data are presented for the same tissues.
Western Blot: SF20/MYDGF Antibody [NBP2-48856]

Western Blot: SF20/MYDGF Antibody [NBP2-48856]

Western Blot: SF20/MYDGF Antibody [NBP2-48856] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856]

Immunohistochemistry-Paraffin: SF20/MYDGF Antibody [NBP2-48856] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for SF20/MYDGF Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SF20/MYDGF

Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation (1). MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages (1). Up-regulation of MYDGF expression was also found during adipocyte differentiation (2). Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway (1). MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP) (3). In HCC, MYDGF could regulate cell proliferation through activating Akt/mitogen-activated protein kinase pathways (3). Mouse MYDGF shares 92% amino acid sequence identity with both human and rat MYDGF. Intriguingly, virtually all homologs of MYDGF have a C-terminal putative ER retention sequence BXEL (B: Arg, His, or Lys; X: variable residue; E: Glu; L: Leu), which has the potential to retain human MYDGF and its homologs in the ER, whereas truncated MYDGF without BXEL is secreted from the cell (4). However, the functions of these different forms remain unclear.

Long Name

Stromal Cell-derived Growth Factor SF20

Alternate Names

C19orf10, Ly6elg, MYDGF

Gene Symbol

MYDGF

Additional SF20/MYDGF Products

Product Documents for SF20/MYDGF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SF20/MYDGF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF20/MYDGF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SF20/MYDGF Antibody - BSA Free and earn rewards!

Have you used SF20/MYDGF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...