SFRS12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87993

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFRS12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SFRS12 Antibody - BSA Free

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human cerebral cortex, liver, small intestine and testis using Anti-SREK1 antibody NBP1-87993 (A) shows similar protein distribution across tissues to independent antibody NBP2-57236 (B).
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining in human testis and skeletal muscle tissues using anti-SREK1 antibody. Corresponding SREK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human liver.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human small intestine.
Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993]

Immunohistochemistry-Paraffin: SFRS12 Antibody [NBP1-87993] - Staining of human cerebral cortex.
SFRS12 Antibody - BSA Free Western Blot: SFRS12 Antibody - BSA Free [NBP1-87993]

Western Blot: SFRS12 Antibody - BSA Free [NBP1-87993]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for SFRS12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS12

SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]

Alternate Names

DKFZp564B176, Serine/arginine-rich-splicing regulatory protein 86, SFRS12serine-arginine-rich-splicing regulatory protein 86, Splicing factor, arginine/serine-rich 12MGC133045, splicing regulatory glutamine/lysine-rich protein 1, Splicing regulatory protein 508, SRRp508, SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508, SRRP86

Gene Symbol

SREK1

Additional SFRS12 Products

Product Documents for SFRS12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFRS12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS12 Antibody - BSA Free and earn rewards!

Have you used SFRS12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies