SGK2 Antibody (4G4) - Azide and BSA Free

Novus Biologicals | Catalog # H00010110-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG3 Kappa Clone # 4G4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

Specificity

SGK2 (4G4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG3 Kappa

Scientific Data Images for SGK2 Antibody (4G4) - Azide and BSA Free

Western Blot: SGK2 Antibody (4G4) [H00010110-M05]

Western Blot: SGK2 Antibody (4G4) [H00010110-M05]

Western Blot: SGK2 Antibody (4G4) [H00010110-M05] - Analysis of SGK2 expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: SGK2 Antibody (4G4) [H00010110-M05]

Immunocytochemistry/ Immunofluorescence: SGK2 Antibody (4G4) [H00010110-M05]

Immunocytochemistry/Immunofluorescence: SGK2 Antibody (4G4) [H00010110-M05] - Analysis of monoclonal antibody to SGK2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: SGK2 Antibody (4G4) [H00010110-M05]

Western Blot: SGK2 Antibody (4G4) [H00010110-M05]

Western Blot: SGK2 Antibody (4G4) [H00010110-M05] - Analysis of SGK2 expression in Raw 264.7.
ELISA: SGK2 Antibody (4G4) [H00010110-M05]

ELISA: SGK2 Antibody (4G4) [H00010110-M05]

ELISA: SGK2 Antibody (4G4) [H00010110-M05] - Detection limit for recombinant GST tagged SGK2 is approximately 0.1ng/ml as a capture antibody.

Applications for SGK2 Antibody (4G4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SGK2

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described.

Long Name

Serine/Threonine Kinase 2

Alternate Names

H-SGK2, Sgkl

Entrez Gene IDs

10110 (Human)

Gene Symbol

SGK2

OMIM

607589 (Human)

Additional SGK2 Products

Product Documents for SGK2 Antibody (4G4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SGK2 Antibody (4G4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SGK2 Antibody (4G4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SGK2 Antibody (4G4) - Azide and BSA Free and earn rewards!

Have you used SGK2 Antibody (4G4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...