SGLT2/SLC5A2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15989

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SGLT2/SLC5A2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SGLT2/SLC5A2 Antibody - Azide and BSA Free

SGLT2/SLC5A2 Antibody - Azide and BSA Free

Western Blot: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] -

Western Blot: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Western blot analysis of various lysates, using SGLT2/SLC5A2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 45s.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody - Azide and BSA Free [NBP3-15989]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody - Azide and BSA Free [NBP3-15989]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP3-15989] - Rat kidney using SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody - Azide and BSA Free [NBP3-15989]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody - Azide and BSA Free [NBP3-15989]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP3-15989] - Mouse kidney using SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
SGLT2/SLC5A2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] -

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded Rat kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SGLT2/SLC5A2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] -

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded Human kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SGLT2/SLC5A2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] -

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded rat kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SGLT2/SLC5A2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 -1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SGLT2/SLC5A2

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Long Name

Solute Carrier Family 5 (Sodium/Glucose Cotransporter), Member 2

Alternate Names

SLC5A2

Gene Symbol

SLC5A2

Additional SGLT2/SLC5A2 Products

Product Documents for SGLT2/SLC5A2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SGLT2/SLC5A2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SGLT2/SLC5A2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SGLT2/SLC5A2 Antibody - Azide and BSA Free and earn rewards!

Have you used SGLT2/SLC5A2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies