SGTA Antibody (2E11) - Azide and BSA Free

Novus Biologicals | Catalog # H00006449-M06

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2E11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA

Specificity

SGTA (2E11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SGTA Antibody (2E11) - Azide and BSA Free

Western Blot: SGTA Antibody (2E11) [H00006449-M06]

Western Blot: SGTA Antibody (2E11) [H00006449-M06]

Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/ Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06]

Immunocytochemistry/ Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06]

Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11.) [H00006449-M06] - SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: SGTA Antibody (2E11) [H00006449-M06]

Western Blot: SGTA Antibody (2E11) [H00006449-M06]

Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in HeLa ( Cat # L013V1 ).
Immunocytochemistry/ Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06]

Immunocytochemistry/ Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06]

Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: SGTA Antibody (2E11) [H00006449-M06] - Detection limit for recombinant GST tagged SGTA is 0.03 ng/ml as a capture antibody.
Immunoprecipitation: SGTA Antibody (2E11) [H00006449-M06]

Immunoprecipitation: SGTA Antibody (2E11) [H00006449-M06]

Immunoprecipitation: SGTA Antibody (2E11) [H00006449-M06] - Analysis of SGTA transfected lysate using anti-SGTA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGTA rabbit polyclonal antibody.

Applications for SGTA Antibody (2E11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SGTA

This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function.

Alternate Names

alphaSGT, alpha-SGT, protein containing three tetratricopeptide repeats, SGT1, SGThSGT, small glutamine-rich tetratricopeptide repeat (TPR)-containing, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha, small glutamine-rich tetratricopeptide repeat-containing protein alpha, UBP, Vpu-binding protein

Entrez Gene IDs

6449 (Human)

Gene Symbol

SGTA

OMIM

603419 (Human)

Additional SGTA Products

Product Documents for SGTA Antibody (2E11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SGTA Antibody (2E11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SGTA Antibody (2E11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SGTA Antibody (2E11) - Azide and BSA Free and earn rewards!

Have you used SGTA Antibody (2E11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...