SHFM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14013

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SHFM3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SHFM3 Antibody - BSA Free

Western Blot: SHFM3 Antibody [NBP2-14013]

Western Blot: SHFM3 Antibody [NBP2-14013]

Western Blot: SHFM3 Antibody [NBP2-14013] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: SHFM3 Antibody [NBP2-14013]

Immunocytochemistry/ Immunofluorescence: SHFM3 Antibody [NBP2-14013]

Immunocytochemistry/Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human lymphoid tissue shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human colon shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013]

Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human pancreas shows moderate cytoplasmic positivity in glandular cells.

Applications for SHFM3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHFM3

SHFM3 is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. [provided by RefSeq]

Alternate Names

DAC, dactylin, F-box and WD repeat domain containing 4, F-box and WD-40 domain protein 4, F-box and WD-40 domain-containing protein 4, F-box/WD repeat protein 4, F-box/WD repeat-containing protein 4, Fbw4, FBW4split hand/foot malformation (ectrodactyly) type 3, FBWD4, SHFM3, SHSF3

Gene Symbol

FBXW4

Additional SHFM3 Products

Product Documents for SHFM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHFM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHFM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHFM3 Antibody - BSA Free and earn rewards!

Have you used SHFM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies