SIRT4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38446

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Sirtuin 4/SIRT4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 29-313 of human SIRT4 (NP_036372.1).

Sequence:
IGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SIRT4 Antibody - BSA Free

SIRT4 Antibody

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] -

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Rat brain using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SIRT4 Antibody

Western Blot: SIRT4 Antibody [NBP3-38446] -

Western Blot: SIRT4 Antibody [NBP3-38446] - Western blot analysis of various lysates using SIRT4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
SIRT4 Antibody

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] -

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Human colon using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SIRT4 Antibody

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] -

Immunohistochemistry: SIRT4 Antibody [NBP3-38446] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using SIRT4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for SIRT4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sirtuin 4/SIRT4

SIRT4 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

Long Name

Silent Mating Type Information Regulation 4 Homolog

Alternate Names

SIR2L4, SIRT4

Gene Symbol

SIRT4

Additional Sirtuin 4/SIRT4 Products

Product Documents for SIRT4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIRT4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics
p53 Pathway

Customer Reviews for SIRT4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIRT4 Antibody - BSA Free and earn rewards!

Have you used SIRT4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies