SKIV2L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84995

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SKIV2L2 Antibody - BSA Free

Western Blot: SKIV2L2 Antibody [NBP1-84995]

Western Blot: SKIV2L2 Antibody [NBP1-84995]

Western Blot: SKIV2L2 Antibody [NBP1-84995] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SKIV2L2 Antibody [NBP1-84995]

Immunocytochemistry/ Immunofluorescence: SKIV2L2 Antibody [NBP1-84995]

Immunocytochemistry/Immunofluorescence: SKIV2L2 Antibody [NBP1-84995] - Staining of human cell line U-2 OS shows positivity in nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: SKIV2L2 Antibody [NBP1-84995]

Western Blot: SKIV2L2 Antibody [NBP1-84995]

Western Blot: SKIV2L2 Antibody [NBP1-84995] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995] - Staining of human skin shows moderate nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995]

Immunohistochemistry-Paraffin: SKIV2L2 Antibody [NBP1-84995] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Applications for SKIV2L2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SKIV2L2

SKIV2L2 may be involved in pre-mRNA splicing

Alternate Names

ATP-dependent helicase SKIV2L2, Dob1, EC 3.6.1, EC 3.6.4.13, fSAP118, KIAA0052functional spliceosome-associated protein 118, MGC142069, Mtr4superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae)

Entrez Gene IDs

23517 (Human)

Gene Symbol

MTREX

UniProt

Additional SKIV2L2 Products

Product Documents for SKIV2L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SKIV2L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SKIV2L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SKIV2L2 Antibody - BSA Free and earn rewards!

Have you used SKIV2L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...