SLC22A16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60040

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC22A16 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC22A16 Antibody - BSA Free

Western Blot: SLC22A16 Antibody [NBP1-60040]

Western Blot: SLC22A16 Antibody [NBP1-60040]

Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040]

Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040]

Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for SLC22A16 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A16

Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].

Alternate Names

Carnitine transporter 2, CT2Organic cation/carnitine transporter 6, Flipt 2, FLIPT2member 16, fly-like putative organic ion transporter 2, Fly-like putative transporter 2, organic cation transporter 6, Organic cation transporter OKB1, solute carrier family 22 (organic cation/carnitine transporter), member 16, solute carrier family 22 member 16

Gene Symbol

SLC22A16

UniProt

Q96RU0 (Human)

Additional SLC22A16 Products

Product Documents for SLC22A16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC22A16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A16 Antibody - BSA Free and earn rewards!

Have you used SLC22A16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC22A16 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I was looking for an SLC22A16 antibody that would work on dog/cat/mouse in WB & IHC -- do you know if yours does please? 

    A:

    the 3 antibodies we have for the SLC22A16 were raised against the human protein sequence peptides. I did a blast homology of each peptide against each dog/cat and mouse and none of the sequences have good enough homology to use in dog/ cat or mouse.
    So we do not have a product that will work for your needs.
    We do have a custom antibody service through our sister company
    https://www.rndsystems.com/services/antibody-production-custom-development-services

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies