SLC25A13 Antibody (4F4) - Azide and BSA Free

Novus Biologicals | Catalog # H00010165-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4F4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC25A13 (NP_055066, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA

Specificity

solute carrier family 25, member 13 (citrin)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SLC25A13 Antibody (4F4) - Azide and BSA Free

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - SLC25A13 monoclonal antibody (M01), clone 4F4 Analysis of SLC25A13 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: SLC25A13 Antibody (4F4) [H00010165-M01]

Immunocytochemistry/ Immunofluorescence: SLC25A13 Antibody (4F4) [H00010165-M01]

Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of monoclonal antibody to SLC25A13 on HepG2 cell. Antibody concentration 10 ug/ml.
Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi ( Cat # H00010165-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody (M01), clone 4F4 (Cat # H00010165-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01]

Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody (M01), clone 4F4.Lane 1: SLC25A13 transfected lysate(74.2 KDa).Lane 2: Non-transfected lysate.
ELISA: SLC25A13 Antibody (4F4) [H00010165-M01]

ELISA: SLC25A13 Antibody (4F4) [H00010165-M01]

ELISA: SLC25A13 Antibody (4F4) [H00010165-M01] - Detection limit for recombinant GST tagged SLC25A13 is approximately 0.3ng/ml as a capture antibody.

Applications for SLC25A13 Antibody (4F4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLC25A13

The SLC25A13 gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton

Alternate Names

ARALAR2CTLN2, calcium-binding mitochondrial carrier protein Aralar2, CITRIN, Mitochondrial aspartate glutamate carrier 2, Solute carrier family 25 member 13, solute carrier family 25, member 13 (citrin)

Entrez Gene IDs

10165 (Human)

Gene Symbol

SLC25A13

OMIM

603471 (Human)

Additional SLC25A13 Products

Product Documents for SLC25A13 Antibody (4F4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A13 Antibody (4F4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC25A13 Antibody (4F4) - Azide and BSA Free

Customer Reviews for SLC25A13 Antibody (4F4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC25A13 Antibody (4F4) - Azide and BSA Free and earn rewards!

Have you used SLC25A13 Antibody (4F4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...