SLC38A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92402

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC38A5 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Analysis in human pancreas and skeletal muscle tissues using NBP1-92402 antibody. Corresponding SLC38A5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402]

Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human stomach shows moderate membranous positivity in glandular cells.
SLC38A5 Antibody - BSA Free Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Staining of human Skeletal muscle shows no positivity in myocytes as expected.
SLC38A5 Antibody - BSA Free Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Staining of human Stomach shows moderate membranous positivity in glandular cells.
SLC38A5 Antibody - BSA Free Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Analysis in human pancreas and skeletal muscle tissues using NBP1-92402 antibody. Corresponding SLC38A5 RNA-seq data are presented for the same tissues.
SLC38A5 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunocytochemistry/ Immunofluorescence: SLC38A5 Antibody - BSA Free [NBP1-92402]

Staining of human cell line HeLa shows localization to plasma membrane, cytosol & vesicles.
SLC38A5 Antibody - BSA Free Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Staining of human Pancreas shows moderate membranous positivity in exocrine glandular cells.
SLC38A5 Antibody - BSA Free Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Immunohistochemistry: SLC38A5 Antibody - BSA Free [NBP1-92402]

Staining of human Liver shows no positivity in hepatocytes as expected.

Applications for SLC38A5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A5

System N amino acid transporters, such as SLC38A5, mediate Na(+)-coupled transport of neutral amino acids, inparticular glutamine, asparagine, and histidine (Nakanishi et al., 2001 (PubMed 11243884)).(supplied by OMIM)

Alternate Names

SN2JM24pp7194, SNAT5, sodium-coupled neutral amino acid transporter 5, Solute carrier family 38 member 5, solute carrier family 38, member 5, System N transporter 2

Gene Symbol

SLC38A5

Additional SLC38A5 Products

Product Documents for SLC38A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC38A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC38A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC38A5 Antibody - BSA Free and earn rewards!

Have you used SLC38A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...