SLC39A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86829

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC39A3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SLC39A3 Antibody [NBP1-86829]

Immunocytochemistry/ Immunofluorescence: SLC39A3 Antibody [NBP1-86829]

Immunocytochemistry/Immunofluorescence: SLC39A3 Antibody [NBP1-86829] - Staining of human cell line U-251 MG shows localization to vesicles.
SLC39A3 Antibody - BSA Free Western Blot: SLC39A3 Antibody - BSA Free [NBP1-86829]

Western Blot: SLC39A3 Antibody - BSA Free [NBP1-86829]

Analysis in control (vector only transfected HEK293T lysate) and SLC39A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
SLC39A3 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Staining of human liver shows strong positivity in cytoplasm granular in hepatocytes.
SLC39A3 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Staining of human testis shows strong positivity in cytoplasm granular in cells in seminiferous ducts and leydig cells.
SLC39A3 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.
SLC39A3 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Immunohistochemistry-Paraffin: SLC39A3 Antibody - BSA Free [NBP1-86829]

Staining of human duodenum shows strong positivity in cytoplasm granular in glandular cells.

Applications for SLC39A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC39A3

SLC39A3 acts as a zinc-influx transporter (Potential)

Alternate Names

solute carrier family 39 (zinc transporter), member 3, zinc transporter ZIP3, ZIP-3, ZIP3Solute carrier family 39 member 3, Zrt- and Irt-like protein 3

Gene Symbol

SLC39A3

Additional SLC39A3 Products

Product Documents for SLC39A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC39A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A3 Antibody - BSA Free and earn rewards!

Have you used SLC39A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...