SLC4A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94138

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC4A4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 (NP_001091954.1). VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

121 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC4A4 Antibody - BSA Free

Western Blot: SLC4A4 AntibodyAzide and BSA Free [NBP2-94138]

Western Blot: SLC4A4 AntibodyAzide and BSA Free [NBP2-94138]

Western Blot: SLC4A4 Antibody [NBP2-94138] - Western blot analysis of extracts of LNCaP cells, using SLC4A4 antibody (NBP2-94138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: SLC4A4 AntibodyAzide and BSA Free [NBP2-94138]

Western Blot: SLC4A4 AntibodyAzide and BSA Free [NBP2-94138]

Western Blot: SLC4A4 Antibody [NBP2-94138] - Western blot analysis of extracts of various cell lines, using SLC4A4 antibody (NBP2-94138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
SLC4A4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SLC4A4 Antibody - Azide and BSA Free [SLC4A4] -

Immunocytochemistry/ Immunofluorescence: SLC4A4 Antibody - Azide and BSA Free [SLC4A4] - Immunofluorescence analysis of C6 cells using SLC4A4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SLC4A4 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC4A4

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Alternate Names

electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5

Gene Symbol

SLC4A4

Additional SLC4A4 Products

Product Documents for SLC4A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC4A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SLC4A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC4A4 Antibody - BSA Free and earn rewards!

Have you used SLC4A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC4A4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Have any of your SLC4A4 antibodies been tested for use in IHC?

    A: The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our Innovators Reward Program. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies