SLMAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81397

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30934005).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLMAP Antibody - BSA Free

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Immunohistochemistry analysis in human smooth muscle and liver tissues using Anti-SLMAP antibody. Corresponding SLMAP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver, lymph node, smooth muscle and testis using Anti-SLMAP antibody NBP1-81397 (A) shows similar protein distribution across tissues to independent antibody NBP1-81398 (B).
Western Blot: SLMAP Antibody [NBP1-81397]

Western Blot: SLMAP Antibody [NBP1-81397]

SLMAP-Antibody-Western-Blot-NBP1-81397-img0027.jpg
Immunocytochemistry/ Immunofluorescence: SLMAP Antibody [NBP1-81397]

Immunocytochemistry/ Immunofluorescence: SLMAP Antibody [NBP1-81397]

Immunocytochemistry/Immunofluorescence: SLMAP Antibody [NBP1-81397] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle shows high expression.
Western Blot: SLMAP Antibody [NBP1-81397]

Western Blot: SLMAP Antibody [NBP1-81397]

Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in human cell line CAPAN-2.
Western Blot: SLMAP Antibody [NBP1-81397]

Western Blot: SLMAP Antibody [NBP1-81397]

Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human testis.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver using Anti-SLMAP antibody NBP1-81397.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle using Anti-SLMAP antibody NBP1-81397.
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]

Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver shows low expression as expected.
SLMAP Antibody

Western Blot: SLMAP Antibody [NBP1-81397] -

Western Blot: SLMAP Antibody [NBP1-81397] - Postnatal expression of SLMAP3 in Tg mice.(A) Schematic representation of the SLMAP3 transgene construct comprising the forkhead associated domain (FHA), the leucine zipper coiled-coil region (LZ), & the transmembrane domain 2 (TM2) in frame with 6-myc tag, driven by alpha -MHC promoter. (B) Number of SLMAP3 transgene copies in hearts. DNA was isolated from hearts of mice & qRT-PCR was performed with appropriate primers to assess copies of Myc-SLMAP3 transgene. (C) SLMAP3 transgene protein expression in Tg mice. Western blot of heart lysate from Wt & Tg mice with anti-myc in high (H), moderate (M), & low (L) SLMAP3-six myc expression, GAPDH was used as loading control. (D) Endogenous SLMAP isoforms in Wt & Tg myocardium. Western blots of SLMAP isoforms in Wt & Tg mice at 5 weeks of age with anti-SLMAP (~35 kDa, ~43 kDa, ~81 kDa, ~91 kDa, & 110 kDa) & anti-myc antibodies (~110 kDa). SLMAP3 image was acquired with a longer exposure of the same membrane. (E) Quantification & fold change of protein expression levels of SLMAP1 (~35 kDa) & SLMAP2 (~43 kDa) isoforms in Tg mice compared to Wt age-matched littermates at 5 weeks of age; Wt corresponds to 1 (100%), n = 3. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLMAP Antibody

Western Blot: SLMAP Antibody [NBP1-81397] -

Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLMAP Antibody

Western Blot: SLMAP Antibody [NBP1-81397] -

Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SLMAP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLMAP

SLMAP may play a role during myoblast fusion

Alternate Names

FLJ42206, KIAA1601Sarcolemmal-associated protein, MGC138760, sarcolemma associated protein, sarcolemmal membrane-associated protein, SLAPMGC138761

Gene Symbol

SLMAP

Additional SLMAP Products

Product Documents for SLMAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLMAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLMAP Antibody - BSA Free

Customer Reviews for SLMAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLMAP Antibody - BSA Free and earn rewards!

Have you used SLMAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...