SLMAP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81397
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 30934005).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SLMAP Antibody - BSA Free
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver, lymph node, smooth muscle and testis using Anti-SLMAP antibody NBP1-81397 (A) shows similar protein distribution across tissues to independent antibody NBP1-81398 (B).Western Blot: SLMAP Antibody [NBP1-81397]
SLMAP-Antibody-Western-Blot-NBP1-81397-img0027.jpgImmunocytochemistry/ Immunofluorescence: SLMAP Antibody [NBP1-81397]
Immunocytochemistry/Immunofluorescence: SLMAP Antibody [NBP1-81397] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle shows high expression.Western Blot: SLMAP Antibody [NBP1-81397]
Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in human cell line CAPAN-2.Western Blot: SLMAP Antibody [NBP1-81397]
Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human testis.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human lymph node.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver using Anti-SLMAP antibody NBP1-81397.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle using Anti-SLMAP antibody NBP1-81397.Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397]
Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver shows low expression as expected.Western Blot: SLMAP Antibody [NBP1-81397] -
Western Blot: SLMAP Antibody [NBP1-81397] - Postnatal expression of SLMAP3 in Tg mice.(A) Schematic representation of the SLMAP3 transgene construct comprising the forkhead associated domain (FHA), the leucine zipper coiled-coil region (LZ), & the transmembrane domain 2 (TM2) in frame with 6-myc tag, driven by alpha -MHC promoter. (B) Number of SLMAP3 transgene copies in hearts. DNA was isolated from hearts of mice & qRT-PCR was performed with appropriate primers to assess copies of Myc-SLMAP3 transgene. (C) SLMAP3 transgene protein expression in Tg mice. Western blot of heart lysate from Wt & Tg mice with anti-myc in high (H), moderate (M), & low (L) SLMAP3-six myc expression, GAPDH was used as loading control. (D) Endogenous SLMAP isoforms in Wt & Tg myocardium. Western blots of SLMAP isoforms in Wt & Tg mice at 5 weeks of age with anti-SLMAP (~35 kDa, ~43 kDa, ~81 kDa, ~91 kDa, & 110 kDa) & anti-myc antibodies (~110 kDa). SLMAP3 image was acquired with a longer exposure of the same membrane. (E) Quantification & fold change of protein expression levels of SLMAP1 (~35 kDa) & SLMAP2 (~43 kDa) isoforms in Tg mice compared to Wt age-matched littermates at 5 weeks of age; Wt corresponds to 1 (100%), n = 3. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SLMAP Antibody [NBP1-81397] -
Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SLMAP Antibody [NBP1-81397] -
Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SLMAP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLMAP
Alternate Names
FLJ42206, KIAA1601Sarcolemmal-associated protein, MGC138760, sarcolemma associated protein, sarcolemmal membrane-associated protein, SLAPMGC138761
Gene Symbol
SLMAP
Additional SLMAP Products
Product Documents for SLMAP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLMAP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SLMAP Antibody - BSA Free
Customer Reviews for SLMAP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLMAP Antibody - BSA Free and earn rewards!
Have you used SLMAP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...