Slug Antibody (3C12) - Azide and BSA Free

Novus Biologicals | Catalog # H00006591-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG3 Kappa Clone # 3C12

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

SNAI2 (3C12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG3 Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Slug Antibody (3C12) - Azide and BSA Free

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]

Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]

Immunocytochemistry/Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on U-2 OS cell. Antibody concentration 10 ug/ml
Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in PC-12 (Cat # L012V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in HepG2 (Cat # L019V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05]

Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in human liver.
Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]

Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]

Immunocytochemistry/Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on HepG2 cell. Antibody concentration 10 ug/ml

Applications for Slug Antibody (3C12) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IF and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Slug

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

Alternate Names

SLUGH1, SNAI2, SNAIL2, WS2D

Entrez Gene IDs

6591 (Human)

Gene Symbol

SNAI2

OMIM

602150 (Human)

Additional Slug Products

Product Documents for Slug Antibody (3C12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Slug Antibody (3C12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Slug Antibody (3C12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Slug Antibody (3C12) - Azide and BSA Free and earn rewards!

Have you used Slug Antibody (3C12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...