Smad2 Antibody (2E3D8)

Novus Biologicals | Catalog # NBP3-15671

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2E3D8 expressed in HEK293
View all Smad2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (Q15796). MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Smad2 Antibody (2E3D8)

Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]

Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]

Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671] - Western blot analysis of extracts of Rat lung, using Smad2 antibody (NBP3-15671) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [NBP3-15671]

Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [NBP3-15671]

Immunocytochemistry/Immunofluorescence: Smad2 Antibody (2E3D8) [NBP3-15671] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Smad2 Rabbit mAb (NBP3-15671) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]

Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]

Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671] - Western blot analysis of extracts of various cell lines, using Smad2 antibody (NBP3-15671) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunoprecipitation: Smad2 Antibody (2E3D8) [NBP3-15671]

Immunoprecipitation: Smad2 Antibody (2E3D8) [NBP3-15671]

Immunoprecipitation: Smad2 Antibody (2E3D8) [NBP3-15671] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Smad2 antibody (NBP3-15671). Western blot was performed from the immunoprecipitate using Smad2 antibody (NBP3-15671) at a dilition of 1:1000.
Smad2 Antibody (2E3D8)

Western Blot: Smad2 Antibody (2E3D8) [Smad2] -

Western Blot: Smad2 Antibody (2E3D8) [Smad2] - Western blot analysis of lysates from wild type (WT) and Smad2 knockdown (KD) HeLa cells using [KD Validated] Smad2 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Smad2 Antibody (2E3D8)

Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [Smad2] -

Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [Smad2] - Confocal imaging of HeLa cells using [KD Validated] Smad2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Smad2 Antibody (2E3D8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Smad2

Smad 2 is a member of the Mothers Against Dpp (MAD)-related family of proteins. So far, nine Smads have been identified and can be divided in 3 subgroups based on their structure and functions; pathway-restricted, common mediator and inhibitory Smad. Smad 2 and 3 serve as pathway-restricted Smads for the TGF-beta/activin signaling pathways (1-2). Smad 2 is phosphorylated by the TGF-beta type 1 receptor kinase on Ser 465 and Ser 467. Phosphorylation of both serines is essential for Smad 2-Smad4 heteromeric complex and dissociation of Smad 2 from the TGF-beta type 1 receptor (3). Once phosphorylated Smad2 translocate to the nucleus where it associates with DNA-binding proteins and forming a transcriptional complex (4). Unlike Smad 3 and 4, Smad 2 does not directly bind DNA (5).

Long Name

Mothers Against DPP Homolog 2

Alternate Names

JV18-1, MADH2, MADR2, Smox

Gene Symbol

SMAD2

Additional Smad2 Products

Product Documents for Smad2 Antibody (2E3D8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Smad2 Antibody (2E3D8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Smad2 Antibody (2E3D8)

There are currently no reviews for this product. Be the first to review Smad2 Antibody (2E3D8) and earn rewards!

Have you used Smad2 Antibody (2E3D8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies