Smad2 Antibody (2E3D8)
Novus Biologicals | Catalog # NBP3-15671
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 2E3D8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (Q15796). MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Smad2 Antibody (2E3D8)
Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]
Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671] - Western blot analysis of extracts of Rat lung, using Smad2 antibody (NBP3-15671) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [NBP3-15671]
Immunocytochemistry/Immunofluorescence: Smad2 Antibody (2E3D8) [NBP3-15671] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Smad2 Rabbit mAb (NBP3-15671) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671]
Western Blot: Smad2 Antibody (2E3D8) [NBP3-15671] - Western blot analysis of extracts of various cell lines, using Smad2 antibody (NBP3-15671) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Immunoprecipitation: Smad2 Antibody (2E3D8) [NBP3-15671]
Immunoprecipitation: Smad2 Antibody (2E3D8) [NBP3-15671] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Smad2 antibody (NBP3-15671). Western blot was performed from the immunoprecipitate using Smad2 antibody (NBP3-15671) at a dilition of 1:1000.Western Blot: Smad2 Antibody (2E3D8) [Smad2] -
Western Blot: Smad2 Antibody (2E3D8) [Smad2] - Western blot analysis of lysates from wild type (WT) and Smad2 knockdown (KD) HeLa cells using [KD Validated] Smad2 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [Smad2] -
Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (2E3D8) [Smad2] - Confocal imaging of HeLa cells using [KD Validated] Smad2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for Smad2 Antibody (2E3D8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Smad2
Long Name
Mothers Against DPP Homolog 2
Alternate Names
JV18-1, MADH2, MADR2, Smox
Gene Symbol
SMAD2
Additional Smad2 Products
Product Documents for Smad2 Antibody (2E3D8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Smad2 Antibody (2E3D8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Smad2 Antibody (2E3D8)
There are currently no reviews for this product. Be the first to review Smad2 Antibody (2E3D8) and earn rewards!
Have you used Smad2 Antibody (2E3D8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...