SNF5 Antibody (9A9G0)

Novus Biologicals | Catalog # NBP3-16159

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A9G0 expressed in HEK293
View all SNF5 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SNF5 (NP_003064.2). LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNF5 Antibody (9A9G0)

Knockout Validated: SNF5 Antibody (9A9G0) [NBP3-16159]

Western Blot: SNF5 Antibody (9A9G0) [NBP3-16159]

Western Blot: SNF5 Antibody (6X6T8) [NBP3-16159] - Western blot analysis of extracts of 293T cells, using SMARCB1/SNF5 antibody (NBP3-16159) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
SNF5 Antibody (9A9G0)

Western Blot: SNF5 Antibody (9A9G0) [NBP3-16159] -

Western Blot: SNF5 Antibody (9A9G0) [NBP3-16159] - Western blot analysis of various lysates, using SNF5 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:2000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
SNF5 Antibody (9A9G0)

Immunoprecipitation: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunoprecipitation: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunoprecipitation of from 300 ug extracts of 293F cells was performed using 3 ug of [KO Validated] SNF5 Rabbit mAb. Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] SNF5 Rabbit mAb at a dilution of 1:12000.
SNF5 Antibody (9A9G0)

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Rat lung using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SNF5 Antibody (9A9G0)

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SNF5 Antibody (9A9G0)

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SNF5 Antibody (9A9G0)

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SNF5 Antibody (9A9G0)

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] -

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human epithelioid sarcoma (ini-1 deletion) using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for SNF5 Antibody (9A9G0)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SNF5

SNF5 is encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

BAF47, BAF47hSNF5, BRG1-associated factor 47, hSNFS, Ini1, INI1RTPS1, Integrase interactor 1 protein, malignant rhabdoid tumor suppressor, RDTSNF5 homolog, Sfh1p, SNF5, SNF5L1, Snr1, subfamily b, member 1, sucrose nonfermenting, yeast, homolog-like 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Gene Symbol

SMARCB1

Additional SNF5 Products

Product Documents for SNF5 Antibody (9A9G0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNF5 Antibody (9A9G0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNF5 Antibody (9A9G0)

There are currently no reviews for this product. Be the first to review SNF5 Antibody (9A9G0) and earn rewards!

Have you used SNF5 Antibody (9A9G0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies