SNRPD1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94494

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SNRPD1 (NP_008869.1). MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SNRPD1 Antibody - Azide and BSA Free

Western Blot: SNRPD1 AntibodyAzide and BSA Free [NBP2-94494]

Western Blot: SNRPD1 AntibodyAzide and BSA Free [NBP2-94494]

Western Blot: SNRPD1 Antibody [NBP2-94494] - Western blot analysis of extracts of various cell lines, using SNRPD1 antibody (NBP2-94494) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-94494] - Immunohistochemistry of paraffin-embedded rat kidney using SNRPD1 Rabbit pAb (NBP2-94494) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-94494] - Immunohistochemistry of paraffin-embedded human breast cancer using SNRPD1 Rabbit pAb (NBP2-94494) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody - Azide and BSA Free [NBP2-94494]

Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-94494] - Immunohistochemistry of paraffin-embedded mouse kidney using SNRPD1 Rabbit pAb (NBP2-94494) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
SNRPD1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SNRPD1 Antibody - Azide and BSA Free [SNRPD1] -

Immunocytochemistry/ Immunofluorescence: SNRPD1 Antibody - Azide and BSA Free [SNRPD1] - Immunofluorescence analysis of U2OS cells using SNRPD1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SNRPD1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SNRPD1 Antibody - Azide and BSA Free [SNRPD1] -

Immunocytochemistry/ Immunofluorescence: SNRPD1 Antibody - Azide and BSA Free [SNRPD1] - Immunofluorescence analysis of HeLa cells using SNRPD1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SNRPD1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SNRPD1

Alternate Names

HsT2456, small nuclear ribonucleoprotein D1 polypeptide 16kDa, small nuclear ribonucleoprotein Sm D1, Sm-D autoantigen, SMD1, Sm-D1, snRNP core protein D1, SNRPD

Gene Symbol

SNRPD1

Additional SNRPD1 Products

Product Documents for SNRPD1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNRPD1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNRPD1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SNRPD1 Antibody - Azide and BSA Free and earn rewards!

Have you used SNRPD1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...