Snx6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13361

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Snx6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Snx6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Snx6 Antibody [NBP2-13361]

Immunocytochemistry/ Immunofluorescence: Snx6 Antibody [NBP2-13361]

Immunocytochemistry/Immunofluorescence: Snx6 Antibody [NBP2-13361] - Staining of human cell line U-2 OS shows localization to endosomes & lysosomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361]

Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361]

Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Snx6 Antibody

Western Blot: Snx6 Antibody [NBP2-13361] -

Western Blot: Snx6 Antibody [NBP2-13361] -Analysis in human cell line HepG2.
Snx6 Antibody

Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361] -

Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361] -Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Snx6 Antibody - BSA Free Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Staining of human kidney shows strong membranous positivity in cells in tubules.
Snx6 Antibody - BSA Free Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Snx6 Antibody - BSA Free Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Staining of human pancreas shows negative cytoplasmic positivity in exocrine glandular cells as expected.
Snx6 Antibody - BSA Free Western Blot: Snx6 Antibody - BSA Free [NBP2-13361]

Western Blot: Snx6 Antibody - BSA Free [NBP2-13361]

Analysis in human cell line HepG2.
Snx6 Antibody - BSA Free Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Immunohistochemistry: Snx6 Antibody - BSA Free [NBP2-13361]

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Applications for Snx6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Snx6

The Snx6 gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associates with the long isoform of the lept

Alternate Names

MGC3157, MSTP010, sorting nexin 6, sorting nexin-6, TFAF2, TRAF4-associated factor 2, tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2

Gene Symbol

SNX6

Additional Snx6 Products

Product Documents for Snx6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Snx6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Snx6 Antibody - BSA Free

Customer Reviews for Snx6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Snx6 Antibody - BSA Free and earn rewards!

Have you used Snx6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies