SPATA5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38302
![Western Blot: SPATA5 Antibody [NBP2-38302]](https://resources.rndsystems.com/images/products/SPATA5-Antibody-Western-Blot-NBP2-38302-img0003.jpg "Western Blot: SPATA5 Antibody [NBP2-38302]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SPATA5 Antibody - BSA Free
Western Blot: SPATA5 Antibody [NBP2-38302]
Western Blot: SPATA5 Antibody [NBP2-38302] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue![Immunocytochemistry/ Immunofluorescence: SPATA5 Antibody [NBP2-38302]](https://resources.rndsystems.com/images/products/SPATA5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38302-img0001.jpg "Immunocytochemistry/ Immunofluorescence: SPATA5 Antibody [NBP2-38302]")
Immunocytochemistry/ Immunofluorescence: SPATA5 Antibody [NBP2-38302]
Immunocytochemistry/Immunofluorescence: SPATA5 Antibody [NBP2-38302] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302]](https://resources.rndsystems.com/images/products/SPATA5-Antibody-Immunohistochemistry-NBP2-38302-img0002.jpg "Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302]")
Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302]
Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: SPATA5 Antibody - BSA Free [NBP2-38302] -
Genetic reconstitution of viral infection by expression of SBDS and SPATA5. (A) Infectivity of Huh7.5 cells treated with indicated CRISPR gRNAs and complemented with lentiviral expression of firefly luciferase (Fluc) or guide-resistant host factors infected with MOI 1 YFV-Venus for 24 h and analyzed by flow cytometry. (B) Lysates from Huh7.5 cells untreated or treated with indicated CRISPR gRNAs and complemented with lentiviral expression of Fluc or guide-resistant host factors were analyzed by Western blotting using anti-SBDS or anti-SPATA5 antibodies. Blot membranes were also probed with anti-actin antibodies (indicated) (n = 3 biological replicates). Statistical significance was determined by two-way ANOVA. KO, knockout; NonTarg or NT, nontargeting CRISPR guides; WT, wild type; ****, P < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36809113), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SPATA5 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SPATA5
Alternate Names
AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5
Gene Symbol
AFG2A
UniProt
Additional SPATA5 Products
Product Documents for SPATA5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SPATA5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SPATA5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SPATA5 Antibody - BSA Free and earn rewards!
Have you used SPATA5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...